Альфа-актинін-1

Матеріал з Вікіпедії — вільної енциклопедії.
(Перенаправлено з ACTN1)
Перейти до навігації Перейти до пошуку
Альфа-актинін-1
Protein ACTN1 PDB 1sjj.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ACTN1, BDPLT15, actinin alpha 1
Зовнішні ІД OMIM: 102575 MGI: 2137706 HomoloGene: 55553 GeneCards: ACTN1
Пов'язані генетичні захворювання
періодонтит, platelet-type bleeding disorder 15[1]
Шаблон експресії
PBB GE ACTN1 211160 x at fs.png

PBB GE ACTN1 208636 at fs.png

PBB GE ACTN1 208637 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001102
NM_001130004
NM_001130005
NM_134156
NM_001346669
RefSeq (білок)
NP_001093
NP_001123476
NP_001123477
NP_001093.1
NP_001333598
NP_598917
Локус (UCSC) Хр. 14: 68.87 – 68.98 Mb Хр. 12: 80.17 – 80.26 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Альфа-актинін-1 (англ. Actinin alpha 1) – білок, який кодується геном ACTN1, розташованим у людей на короткому плечі 14-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 892 амінокислот, а молекулярна маса — 103 058[5].

Послідовність амінокислот
1020304050
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGT
QIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFI
ASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGL
LLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDD
PLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFS
GAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENR
VPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNR
PAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFR
QKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDR
VEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERT
EKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTA
HEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI
NGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKM
EEIGRISIEMHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALI
FDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNE
FRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQGEAEFARIMSIVD
PNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITMDELRR
ELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL

Білок має сайт для зв'язування з молекулою актину, іонами металів, іоном кальцію. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних контактах, клітинних відростках.

Література[ред. | ред. код]

  • Millake D.B., Blanchard A.D., Patel B., Critchley D.R. (1989). The cDNA sequence of a human placental alpha-actinin.. Nucleic Acids Res. 17: 6725 — 6725.  PubMed DOI:10.1093/nar/17.16.6725
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Egerton M., Moritz R.L., Druker B., Kelso A., Simpson R.J. (1996). Identification of the 70kD heat shock cognate protein (Hsc70) and alpha-actinin-1 as novel phosphotyrosine-containing proteins in T lymphocytes.. Biochem. Biophys. Res. Commun. 224: 666 — 674.  PubMed DOI:10.1006/bbrc.1996.1082
  • Dubernard V., Faucher D., Launay J.-M., Legrand C. (1995). Identification of the cytoskeletal protein alpha-actinin as a platelet thrombospondin-binding protein.. FEBS Lett. 364: 109 — 114.  PubMed DOI:10.1016/0014-5793(95)00362-D
  • Frey N., Richardson J.A., Olson E.N. (2000). Calsarcins, a novel family of sarcomeric calcineurin-binding proteins.. Proc. Natl. Acad. Sci. U.S.A. 97: 14632 — 14637.  PubMed DOI:10.1073/pnas.260501097
  • Li B., Zhuang L., Reinhard M., Trueb B. (2003). The lipoma preferred partner LPP interacts with alpha-actinin.. J. Cell Sci. 116: 1359 — 1366.  PubMed DOI:10.1242/jcs.00309

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]