APC (ген)

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
APC
PBB Protein APC image.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи APC, BTPS2, DP2, DP2.5, DP3, GS, PPP1R46, adenomatous polyposis coli, WNT signaling pathway regulator
Зовнішні ІД MGI: 88039 HomoloGene: 30950 GeneCards: APC
Шаблон експресії
PBB GE APC 216933 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001127511
NM_000038
NM_001127510
NM_007462
NM_001360979
NM_001360980
RefSeq (білок)
н/д
Локус (UCSC) н/д Хр. 18: 34.22 – 34.32 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

APC (англ. APC, WNT signaling pathway regulator) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 2 843 амінокислот, а молекулярна маса — 311 646[4].

Послідовність амінокислот
1020304050
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQ
LQGSIEDEAMASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSRE
GSVSSRSGECSPVPMGSFPRRGFVNGSRESTGYLEELEKERSLLLADLDK
EEKEKDWYYAQLQNLTKRIDSLPLTENFSLQTDMTRRQLEYEARQIRVAM
EEQLGTCQDMEKRAQRRIARIQQIEKDILRIRQLLQSQATEAERSSQNKH
ETGSHDAERQNEGQGVGEINMATSGNGQGSTTRMDHETASVLSSSSTHSA
PRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQS
GCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRG
RREIRVLHLLEQIRAYCETCWEWQEAHEPGMDQDKNPMPAPVEHQICPAV
CVLMKLSFDEEHRHAMNELGGLQAIAELLQVDCEMYGLTNDHYSITLRRY
AGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRN
LSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCT
ENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNE
DHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWD
MGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLP
SLHVRKQKALEAELDAQHLSETFDNIDNLSPKASHRSKQRHKQSLYGDYV
FDTNRHDDNRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGSLDSSRSEKDR
SLERERGIGLGNYHPATENPGTSSKRGLQISTTAAQIAKVMEEVSAIHTS
QEDRSSGSTTELHCVTDERNALRRSSAAHTHSNTYNFTKSENSNRTCSMP
YAKLEYKRSSNDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQY
PADLAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWA
RPKHIIEDEIKQSEQRQSRNQSTTYPVYTESTDDKHLKFQPHFGQQECVS
PYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKPTNYSERYSEE
EQHEEEERPTNYSIKYNEEKRHVDQPIDYSLKYATDIPSSQKQSFSFSKS
SSGQSSKTEHMSSSSENTSTPSSNAKRQNQLHPSSAQSRSGQPQKAATCK
VSSINQETIQTYCVEDTPICFSRCSSLSSLSSAEDEIGCNQTTQEADSAN
TLQIAEIKEKIGTRSAEDPVSEVPAVSQHPRTKSSRLQGSSLSSESARHK
AVEFSSGAKSPSKSGAQTPKSPPEHYVQETPLMFSRCTSVSSLDSFESRS
IASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPPPPPQTAQTKR
EVPKNKAPTAEKRESGPKQAAVNAAVQRVQVLPDADTLLHFATESTPDGF
SCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPKESNENQE
KEAEKTIDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKPAQTASK
LPPPVARKPSQLPVYKLLPSQNRLQPQKHVSFTPGDDMPRVYCVEGTPIN
FSTATSLSDLTIESPPNELAAGEGVRGGAQSGEFEKRDTIPTEGRSTDEA
QGGKTSSVTIPELDDNKAEEGDILAECINSAMPKGKSHKPFRVKKIMDQV
QQASASSSAPNKNQLDGKKKKPTSPVKPIPQNTEYRTRVRKNADSKNNLN
AERVFSDNKDSKKQNLKNNSKVFNDKLPNNEDRVRGSFAFDSPHHYTPIE
GTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKAKENKESEAKVTSHTEL
TSNQQSANKTQAIAKQPINRGQPKPILQKQSTFPQSSKDIPDRGAATDEK
LQNFAIENTPVCFSHNSSLSSLSDIDQENNNKENEPIKETEPPDSQGEPS
KPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQECISSAMPKK
KKPSRLKGDNEKHSPRNMGGILGEDLTLDLKDIQRPDSEHGLSPDSENFD
WKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHL
TPDQEEKPFTSNKGPRILKPGEKSTLETKKIESESKGIKGGKKVYKSLIT
GKVRSNSEISGQMKQPLQANMPSISRGRTMIHIPGVRNSSSSTSPVSKKG
PPLKTPASKSPSEGQTATTSPRGAKPSVKSELSPVARQTSQIGGSSKAPS
RSGSRDSTPSRPAQQPLSRPIQSPGRNSISPGRNGISPPNKLSQLPRTSS
PSTASTKSSGSGKMSYTSPGRQMSQQNLTKQTGLSKNASSIPRSESASKG
LNQMNNGNGANKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSP
TLRRKLEESASFESLSPSSRPASPTRSQAQTPVLSPSLPDMSLSTHSSVQ
AGGWRKLPPNLSPTIEYNDGRPAKRHDIARSHSESPSRLPINRSGTWKRE
HSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDEKHVNSISGTKQ
SKENQVSAKGTWRKIKENEFSPTNSTSQTVSSGATNGAESKTLIYQMAPA
VSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKANPNIKDSKDN
QAKQNVGNGSVPMRTVGLENRLNSFIQVDAPDQKGTEIKPGQNNPVPVSE
TNESSIVERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSA
RPSQIPTPVNNNTKKRDSKTDSTESSGTQSPKRHSGSYLVTSV

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як сигнальний шлях Wnt, поліморфізм, ацетилювання, альтернативний сплайсинг. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних контактах, клітинних відростках.

Література[ред. | ред. код]

  • Su L.-K., Vogelstein B., Kinzler K.W. (1993). Association of the APC tumor suppressor protein with catenins.. Science 262: 1734 — 1737.  PubMed DOI:10.1126/science.8259519
  • Bu W., Su L.-K. (2003). Characterization of functional domains of human EB1 family proteins.. J. Biol. Chem. 278: 49721 — 49731.  PubMed DOI:10.1074/jbc.M306194200
  • Choi J., Park S.Y., Costantini F., Jho E.-H., Joo C.-K. (2004). Adenomatous polyposis coli is down-regulated by the ubiquitin-proteasome pathway in a process facilitated by Axin.. J. Biol. Chem. 279: 49188 — 49198.  PubMed DOI:10.1074/jbc.M404655200
  • Tran H., Hamada F., Schwarz-Romond T., Bienz M. (2008). Trabid, a new positive regulator of Wnt-induced transcription with preference for binding and cleaving K63-linked ubiquitin chains.. Genes Dev. 22: 528 — 542.  PubMed DOI:10.1101/gad.463208
  • Zaoui K., Benseddik K., Daou P., Salaun D., Badache A. (2010). ErbB2 receptor controls microtubule capture by recruiting ACF7 to the plasma membrane of migrating cells.. Proc. Natl. Acad. Sci. U.S.A. 107: 18517 — 18522.  PubMed DOI:10.1073/pnas.1000975107
  • Pfister A.S., Tanneberger K., Schambony A., Behrens J. (2012). Amer2 protein is a novel negative regulator of Wnt/beta-Catenin signaling involved in neuroectodermal patterning.. J. Biol. Chem. 287: 1734 — 1741.  PubMed DOI:10.1074/jbc.M111.308650

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:583 (англ.). Процитовано 31 серпня 2017. 
  4. UniProt, P25054 (англ.). Процитовано 31 серпня 2017. 

Див. також[ред. | ред. код]