JUP

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
JUP
Ідентифікатори
Символи catenin (cadherin-associated protein)gamma 80kDaJUPdesmoplakin IIICatenin gammadesmoplakin-3junction plakoglobin
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

JUP (англ. Junction plakoglobin) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 745 амінокислот, а молекулярна маса — 81 745[2].

Послідовність амінокислот
1020304050
MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACG
RQYTLKKTTTYTQGVPPSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSL
LLATQVEGQATNLQRLAEPSQLLKSAIVHLINYQDDAELATRALPELTKL
LNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLD
TARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTL
HNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQ
ESKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVE
AGGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQL
SVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDD
ITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKA
TIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPY
TDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENI
QRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLF
RISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDMDAT
YRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинна адгезія, ацетилювання. Локалізований у цитоплазмі, цитоскелеті, мембрані, клітинних контактах.

Література[ред. | ред. код]

  • Whittock N.V., Eady R.A.J., McGrath J.A. (2000). Genomic organization and amplification of the human plakoglobin gene (JUP).. Exp. Dermatol. 9: 323 — 326.  PubMed DOI:10.1034/j.1600-0625.2000.009005323.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Butz S., Kemler R. (1994). Distinct cadherin-catenin complexes in Ca(2+)-dependent cell-cell adhesion.. FEBS Lett. 355: 195 — 200.  PubMed DOI:10.1016/0014-5793(94)01205-9
  • Yamamoto M., Bharti A., Li Y., Kufe D. (1997). Interaction of the DF3/MUC1 breast carcinoma-associated antigen and beta-catenin in cell adhesion.. J. Biol. Chem. 272: 12492 — 12494.  PubMed DOI:10.1074/jbc.272.19.12492
  • Holsinger L.J., Ward K., Duffield B., Zachwieja J., Jallal B. (2002). The transmembrane receptor protein tyrosine phosphatase DEP1 interacts with p120(ctn).. Oncogene 21: 7067 — 7076.  PubMed DOI:10.1038/sj.onc.1205858
  • Hatsell S., Medina L., Merola J., Haltiwanger R., Cowin P. (2003). Plakoglobin is O-glycosylated close to the N-terminal destruction box.. J. Biol. Chem. 278: 37745 — 37752.  PubMed DOI:10.1074/jbc.M301346200

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:6207 (англ.). Процитовано 12 вересня 2017. 
  2. UniProt, P14923 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]