KIF4A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KIF4A
Ідентифікатори
Символи KIF4A, KIF4, KIF4G1, MRX100, kinesin family member 4A
Зовнішні ІД OMIM: 300521 MGI: 108389 HomoloGene: 69022 GeneCards: KIF4A
Шаблон експресії
PBB GE KIF4A 218355 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_012310
NM_008446
RefSeq (білок)
NP_036442
NP_032472
Локус (UCSC) Хр. X: 70.29 – 70.42 Mb Хр. X: 100.63 – 100.73 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KIF4A (англ. Kinesin family member 4A) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[3] Довжина поліпептидного ланцюга білка становить 1 232 амінокислот, а молекулярна маса — 139 881[4].

Послідовність амінокислот
1020304050
MKEEVKGIPVRVALRCRPLVPKEISEGCQMCLSFVPGEPQVVVGTDKSFT
YDFVFDPSTEQEEVFNTAVAPLIKGVFKGYNATVLAYGQTGSGKTYSMGG
AYTAEQENEPTVGVIPRVIQLLFKEIDKKSDFEFTLKVSYLEIYNEEILD
LLCPSREKAQINIREDPKEGIKIVGLTEKTVLVALDTVSCLEQGNNSRTV
ASTAMNSQSSRSHAIFTISLEQRKKSDKNSSFRSKLHLVDLAGSERQKKT
KAEGDRLKEGININRGLLCLGNVISALGDDKKGGFVPYRDSKLTRLLQDS
LGGNSHTLMIACVSPADSNLEETLNTLRYADRARKIKNKPIVNIDPQTAE
LNHLKQQVQQLQVLLLQAHGGTLPGSITVEPSENLQSLMEKNQSLVEENE
KLSRGLSEAAGQTAQMLERIILTEQANEKMNAKLEELRQHAACKLDLQKL
VETLEDQELKENVEIICNLQQLITQLSDETVACMAAAIDTAVEQEAQVET
SPETSRSSDAFTTQHALRQAQMSKELVELNKALALKEALARKMTQNDSQL
QPIQYQYQDNIKELELEVINLQKEKEELVLELQTAKKDANQAKLSERRRK
RLQELEGQIADLKKKLNEQSKLLKLKESTERTVSKLNQEIRMMKNQRVQL
MRQMKEDAEKFRQWKQKKDKEVIQLKERDRKRQYELLKLERNFQKQSNVL
RRKTEEAAAANKRLKDALQKQREVADKRKETQSRGMEGTAARVKNWLGNE
IEVMVSTEEAKRHLNDLLEDRKILAQDVAQLKEKKESGENPPPKLRRRTF
SLTEVRGQVSESEDSITKQIESLETEMEFRSAQIADLQQKLLDAESEDRP
KQRWENIATILEAKCALKYLIGELVSSKIQVSKLESSLKQSKTSCADMQK
MLFEERNHFAEIETELQAELVRMEQQHQEKVLYLLSQLQQSQMAEKQLEE
SVSEKEQQLLSTLKCQDEELEKMREVCEQNQQLLRENEIIKQKLTLLQVA
SRQKHLPKDTLLSPDSSFEYVPPKPKPSRVKEKFLEQSMDIEDLKYCSEH
SVNEHEDGDGDDDEGDDEEWKPTKLVKVSRKNIQGCSCKGWCGNKQCGCR
KQKSDCGVDCCCDPTKCRNRQQGKDSLGTVERTQDSEGSFKLEDPTEVTP
GLSFFNPVCATPNSKILKEMCDVEQVLSKKTPPAPSPFDLPELKHVATEY
QENKAPGKKKKRALASNTSFFSGCSPIEEEAH

Кодований геном білок за функціями належить до білкових моторів, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, ДНК. Локалізований у цитоплазмі, цитоскелеті, ядрі, хромосомах.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Yan R.-T., Wang S.-Z. (1997). Increased chromokinesin immunoreactivity in retinoblastoma cells.. Gene 189: 263 — 267.  PubMed DOI:10.1016/S0378-1119(96)00860-8
  • Kurasawa Y., Earnshaw W.C., Mochizuki Y., Dohmae N., Todokoro K. (2004). Essential roles of KIF4 and its binding partner PRC1 in organized central spindle midzone formation.. EMBO J. 23: 3237 — 3248.  PubMed DOI:10.1038/sj.emboj.7600347
  • Zhu C., Jiang W. (2005). Cell cycle-dependent translocation of PRC1 on the spindle by Kif4 is essential for midzone formation and cytokinesis.. Proc. Natl. Acad. Sci. U.S.A. 102: 343 — 348.  PubMed DOI:10.1073/pnas.0408438102
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13339 (англ.). Процитовано 13 вересня 2017. 
  4. UniProt, O95239 (англ.). Процитовано 13 вересня 2017. 

Див. також[ред. | ред. код]