KIF23

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KIF23
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KIF23, CHO1, KNSL5, MKLP-1, MKLP1, kinesin family member 23
Зовнішні ІД OMIM: 605064 MGI: 1919069 HomoloGene: 11491 GeneCards: KIF23
Шаблон експресії
PBB GE KIF23 204709 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001281301
NM_004856
NM_138555
NM_001367804
NM_001367805
NM_024245
RefSeq (білок)
NP_001268230
NP_004847
NP_612565
NP_001354733
NP_001354734
NP_077207
Локус (UCSC) Хр. 15: 69.41 – 69.45 Mb Хр. 9: 61.92 – 61.95 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KIF23 (англ. Kinesin family member 23) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 960 амінокислот, а молекулярна маса — 110 059[4].

Послідовність амінокислот
1020304050
MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNT
TVQLHTPEGYRLNRNGDYKETQYSFKQVFGTHTTQKELFDVVANPLVNDL
IHGKNGLLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIFNSIGSFQAKR
YVFKSNDRNSMDIQCEVDALLERQKREAMPNPKTSSSKRQVDPEFADMIT
VQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVPFDPIKPKPPQSK
LLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSR
SHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAE
GNRLREAGNINQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNY
FDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEVEVARPVDKAICGLT
PGRRYRNQPRGPVGNEPLVTDVVLQSFPPLPSCEILDINDEQTLPRLIEA
LEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLNEKEKM
ISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKL
QRQFSDKRRLEARLQGMVTETTMKWEKECERRVAAKQLEMQNKLWVKDEK
LKQLKAIVTEPKTEKPERPSRERDREKVTQRSVSPSPVPLSSNYIAQISN
GQQLMSQPQLHRRSNSCSSISVASCISEWEQKIPTYNTPLKVTSIARRRQ
QEPGQSKTCIVSDRRRGMYWTEGREVVPTFRNEIEIEEDHCGRLLFQPDQ
NAPPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEK
ALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQ
ESPNGSRKRRSSTVAPAQPDGAESEWTDVETRCSVAVEMRAGSQLGPGYQ
HHAQPKRKKP

Кодований геном білок за функціями належить до білкових моторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинний цикл, поділ клітини, мітоз, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті, ядрі.

Література[ред. | ред. код]

  • Nislow C., Lombillo V.A., Kuriyama R., McIntosh J.R. (1992). A plus-end-directed motor enzyme that moves antiparallel microtubules in vitro localizes to the interzone of mitotic spindles.. Nature 359: 543 — 547.  PubMed DOI:10.1038/359543a0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Mishima M., Kaitna S., Glotzer M. (2002). Central spindle assembly and cytokinesis require a kinesin-like protein/RhoGAP complex with microtubule bundling activity.. Dev. Cell 2: 41 — 54.  PubMed DOI:10.1016/S1534-5807(01)00110-1
  • Kurasawa Y., Earnshaw W.C., Mochizuki Y., Dohmae N., Todokoro K. (2004). Essential roles of KIF4 and its binding partner PRC1 in organized central spindle midzone formation.. EMBO J. 23: 3237 — 3248.  PubMed DOI:10.1038/sj.emboj.7600347
  • Tomas A., Futter C., Moss S.E. (2004). Annexin 11 is required for midbody formation and completion of the terminal phase of cytokinesis.. J. Cell Biol. 165: 813 — 822.  PubMed DOI:10.1083/jcb.200311054
  • Yuce O., Piekny A., Glotzer M. (2005). An ECT2-centralspindlin complex regulates the localization and function of RhoA.. J. Cell Biol. 170: 571 — 582.  PubMed DOI:10.1083/jcb.200501097

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6392 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q02241 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]