ACTG2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ACTG2
PBB Protein ACTA1 image.jpg
Ідентифікатори
Символи ACTG2, ACT, ACTA3, ACTE, ACTL3, ACTSG, VSCM, actin, gamma 2, smooth muscle, enteric, actin gamma 2, smooth muscle
Зовнішні ІД OMIM: 102545 MGI: 104589 HomoloGene: 123845 GeneCards: ACTG2
Шаблон експресії
PBB GE ACTG2 202274 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001615
NM_001199893
NM_009610
RefSeq (білок)
NP_001186822
NP_001606
NP_033740
Локус (UCSC) Хр. 2: 73.89 – 73.92 Mb Хр. 6: 83.51 – 83.54 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ACTG2 (англ. Actin, gamma 2, smooth muscle, enteric) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 376 амінокислот, а молекулярна маса — 41 877[4].

Послідовність амінокислот
1020304050
MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ
KDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPE
EHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTT
GIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYS
FVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVIT
IGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVL
SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASL
STFQQMWISKPEYDEAGPSIVHRKCF

Кодований геном білок за функцією належить до м'язових білків. Задіяний у таких біологічних процесах як ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Miwa T., Kamada S., Kakunaga T. (1990). The nucleotide sequence of a human smooth muscle (enteric type) gamma-actin cDNA.. Nucleic Acids Res. 18: 4263 — 4263.  PubMed DOI:10.1093/nar/18.14.4263
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Holla O.L., Bock G., Busk O.L., Isfoss B.L. (2014). Familial visceral myopathy diagnosed by exome sequencing of a patient with chronic intestinal pseudo-obstruction.. Endoscopy 46: 533 — 537.  PubMed DOI:10.1055/s-0034-1365142

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:145 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, P63267 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]