TNNI2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TNNI2
Protein TNNI2 PDB 1a2x.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TNNI2, AMCD2B, DA2B, FSSV, fsTnI, troponin I2, fast skeletal type, DA2B1
Зовнішні ІД OMIM: 191043 MGI: 105070 HomoloGene: 37752 GeneCards: TNNI2
Шаблон експресії
PBB GE TNNI2 206393 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003282
NM_001145829
NM_001145841
NM_009405
RefSeq (білок)
NP_001139301
NP_001139313
NP_003273
NP_033431
Локус (UCSC) Хр. 11: 1.84 – 1.84 Mb Хр. 7: 142.44 – 142.44 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TNNI2 (англ. Troponin I2, fast skeletal type) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 182 амінокислот, а молекулярна маса — 21 339[4].

Послідовність амінокислот
1020304050
MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCP
PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
FDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRANLKQVKKEDTE
KERDLRDVGDWRKNIEEKSGMEGRKKMFESES

Кодований геном білок за функціями належить до м'язових білків, фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою актину.

Література[ред. | ред. код]

  • Zhu L., Perez-Alvarado G., Wade R. (1994). Sequencing of a cDNA encoding the human fast-twitch skeletal muscle isoform of troponin I.. Biochim. Biophys. Acta 1217: 338 — 340.  PubMed DOI:10.1016/0167-4781(94)90297-6
  • Mullen A.J., Barton P.J.R. (2000). Structural characterization of the human fast skeletal muscle troponin I gene (TNNI2).. Gene 242: 313 — 320.  PubMed DOI:10.1016/S0378-1119(99)00519-3
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11946 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, P48788 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]