KRT20

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KRT20
Ідентифікатори
Символи KRT20, CD20, CK-20, CK20, K20, KRT21, keratin 20
Зовнішні ІД OMIM: 608218 MGI: 1914059 HomoloGene: 56837 GeneCards: KRT20
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_019010
NM_023256
RefSeq (білок)
NP_061883
NP_075745
Локус (UCSC) Хр. 17: 40.88 – 40.89 Mb Хр. 11: 99.43 – 99.44 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KRT20 (англ. Keratin 20) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 424 амінокислот, а молекулярна маса — 48 487[4].

Послідовність амінокислот
1020304050
MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSR
HTVNYGSDLTGGGDLFVGNEKMAMQNLNDRLASYLEKVRTLEQSNSKLEV
QIKQWYETNAPRAGRDYSAYYRQIEELRSQIKDAQLQNARCVLQIDNAKL
AAEDFRLKYETERGIRLTVEADLQGLNKVFDDLTLHKTDLEIQIEELNKD
LALLKKEHQEEVDGLHKHLGNTVNVEVDAAPGLNLGVIMNEMRQKYEVMA
QKNLQEAKEQFERQTAVLQQQVTVNTEELKGTEVQLTELRRTSQSLEIEL
QSHLSMKESLEHTLEETKARYSSQLANLQSLLSSLEAQLMQIRSNMERQN
NEYHILLDIKTRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKI
KTVVQEVVDGKVVSSEVKEVEENI

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як апоптоз. Локалізований у цитоплазмі, проміжних філаментах.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Calnek D., Quaroni A. (1993). Differential localization by in situ hybridization of distinct keratin mRNA species during intestinal epithelial cell development and differentiation.. Differentiation 53: 95 — 104.  PubMed DOI:10.1111/j.1432-0436.1993.tb00649.x
  • Moll R., Schiller D.L., Franke W.W. (1990). Identification of protein IT of the intestinal cytoskeleton as a novel type I cytokeratin with unusual properties and expression patterns.. J. Cell Biol. 111: 567 — 580.  PubMed DOI:10.1083/jcb.111.2.567
  • Barrett A.W., Cort E.M., Patel P., Berkovitz B.K.B. (2000). An immunohistological study of cytokeratin 20 in human and mammalian oral epithelium.. Arch. Oral Biol. 45: 879 — 887.  PubMed DOI:10.1016/S0003-9969(00)00050-9

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:20412 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P35900 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]