MYLK3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYLK3
Ідентифікатори
Символи MYLK3, MLCK, MLCK2, caMLCK, myosin light chain kinase 3
Зовнішні ІД OMIM: 612147 MGI: 2443063 HomoloGene: 35278 GeneCards: MYLK3
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001308301
NM_182493
NM_001297612
NM_175441
RefSeq (білок)
NP_001295230
NP_872299
NP_001284541
NP_780650
Локус (UCSC) Хр. 16: 46.7 – 46.79 Mb Хр. 8: 85.32 – 85.39 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYLK3 (англ. Myosin light chain kinase 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 819 амінокислот, а молекулярна маса — 88 393[4].

Послідовність амінокислот
1020304050
MSGTSKESLGHGGLPGLGKTCLTTMDTKLNMLNEKVDQLLHFQEDVTEKL
QSMCRDMGHLERGLHRLEASRAPGPGGADGVPHIDTQAGWPEVLELVRAM
QQDAAQHGARLEALFRMVAAVDRAIALVGATFQKSKVADFLMQGRVPWRR
GSPGDSPEENKERVEEEGGKPKHVLSTSGVQSDAREPGEESQKADVLEGT
AERLPPIRASGLGADPAQAVVSPGQGDGVPGPAQAFPGHLPLPTKVEAKA
PETPSENLRTGLELAPAPGRVNVVSPSLEVAPGAGQGASSSRPDPEPLEE
GTRLTPGPGPQCPGPPGLPAQARATHSGGETPPRISIHIQEMDTPGEMLM
TGRGSLGPTLTTEAPAAAQPGKQGPPGTGRCLQAPGTEPGEQTPEGAREL
SPLQESSSPGGVKAEEEQRAGAEPGTRPSLARSDDNDHEVGALGLQQGKS
PGAGNPEPEQDCAARAPVRAEAVRRMPPGAEAGSVVLDDSPAPPAPFEHR
VVSVKETSISAGYEVCQHEVLGGGRFGQVHRCTEKSTGLPLAAKIIKVKS
AKDREDVKNEINIMNQLSHVNLIQLYDAFESKHSCTLVMEYVDGGELFDR
ITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVNQTGH
QIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGV
ITYMLLSGLSPFLGETDAETMNFIVNCSWDFDADTFEGLSEEAKDFVSRL
LVKEKSCRMSATQCLKHEWLNNLPAKASRSKTRLKSQLLLQKYIAQRKWK
KHFYVVTAANRLRKFPTSP

Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, іоном магнію. Локалізований у цитоплазмі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:29826 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q32MK0 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]