MYH6

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYH6
Protein MYH6 PDB 2fxm.png
Ідентифікатори
Символи MYH6, ASD3, CMD1EE, CMH14, MYHC, MYHCA, SSS3, alpha-MHC, myosin, heavy chain 6, cardiac muscle, alpha, myosin heavy chain 6
Зовнішні ІД OMIM: 160710 MGI: 97255 HomoloGene: 124414 GeneCards: MYH6
Пов'язані генетичні захворювання
atrial heart septal defect 3, hypertrophic cardiomyopathy 14, dilated cardiomyopathy 1EE[1]
Шаблон експресії
PBB GE MYH6 214468 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002471
NM_001164171
NM_010856
RefSeq (білок)
NP_002462
NP_001157643
NP_034986
Локус (UCSC) Хр. 14: 23.38 – 23.41 Mb Хр. 14: 54.94 – 54.97 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYH6 (англ. Myosin heavy chain 6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 939 амінокислот, а молекулярна маса — 223 735[5].

Послідовність амінокислот
1020304050
MTDAQMADFGAAAQYLRKSEKERLEAQTRPFDIRTECFVPDDKEEFVKAK
ILSREGGKVIAETENGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPA
VLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEA
PPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAA
IGDRGKKDNANANKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIR
IHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLD
MLLVTNNPYDYAFVSQGEVSVASIDDSEELMATDSAFDVLGFTSEEKAGV
YKLTGAIMHYGNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGL
CHPRVKVGNEYVTKGQSVQQVYYSIGALAKAVYEKMFNWMVTRINATLET
KQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQE
EYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFK
AKLYDNHLGKSNNFQKPRNIKGKQEAHFSLIHYAGTVDYNILGWLEKNKD
PLNETVVALYQKSSLKLMATLFSSYATADTGDSGKSKGGKKKGSSFQTVS
ALHRENLNKLMTNLRTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGV
LEGIRICRKGFPNRILYGDFRQRYRILNPVAIPEGQFIDSRKGTEKLLSS
LDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRMQAQARGQLMR
IEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKE
MATMKEEFGRIKETLEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNL
NDAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECS
ELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKA
LQEAHQQALDDLQVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDL
ERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQ
VLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISE
RLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHAD
SVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKV
SRTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALI
SQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSARHDCDLLREQYE
EETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQ
DAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRN
FDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETF
KRENKNLQEEISDLTEQLGEGGKNVHELEKVRKQLEVEKLELQSALEEAE
ASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHQRVVDSLQ
TSLDAETRSRNEVLRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQS
LLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERS
RKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQSEVEEAVQEC
RNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLD
EAEQIALKGGKKQLQKLEARVRELEGELEAEQKRNAESVKGMRKSERRIK
ELTYQTEEDKKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRK
VQHELDEAEERADIAESQVNKLRAKSRDIGAKQKMHDEE

Кодований геном білок за функціями належить до білкових моторів, міозинів, м'язових білків, фосфопротеїнів. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою актину, молекулою кальмодуліну. Локалізований у цитоплазмі.

Література[ред. | ред. код]

  • Matsuoka R., Beisel K.W., Furutani M., Arai S., Takao A. (1991). Complete sequence of human cardiac alpha-myosin heavy chain gene and amino acid comparison to other myosins based on structural and functional differences.. Am. J. Med. Genet. 41: 537 — 547.  PubMed DOI:10.1002/ajmg.1320410435
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Yamauchi-Takihara K., Sole M.J., Liew J., Ing D., Liew C.-C. (1989). Characterization of human cardiac myosin heavy chain genes.. Proc. Natl. Acad. Sci. U.S.A. 86: 3504 — 3508.  PubMed DOI:10.1073/pnas.86.10.3504
  • Kurabayashi M., Tsuchimochi H., Komuro I., Takaku F., Yazaki Y. (1988). Molecular cloning and characterization of human cardiac alpha- and beta-form myosin heavy chain complementary DNA clones. Regulation of expression during development and pressure overload in human atrium.. J. Clin. Invest. 82: 524 — 531.  PubMed DOI:10.1172/JCI113627
  • Epp T.A., Dixon I.M., Wang H.Y., Sole M.J., Liew C.-C. (1993). Structural organization of the human cardiac alpha-myosin heavy chain gene (MYH6).. Genomics 18: 505 — 509.  PubMed
  • Yamauchi-Takihara K., Sole M.J., Liew J., Ing D., Liew C.-C. (1989). Proc. Natl. Acad. Sci. U.S.A. 86: 7416 — 7417. 

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]