Талін-1

Матеріал з Вікіпедії — вільної енциклопедії.
(Перенаправлено з TLN1)
Перейти до навігації Перейти до пошуку
Талін-1
Protein TLN1 PDB 1mix.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TLN1, ILWEQ, TLN, talin 1, talin-1
Зовнішні ІД OMIM: 186745 MGI: 1099832 HomoloGene: 21267 GeneCards: TLN1
Шаблон експресії
PBB GE TLN1 203254 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006289
NM_011602
RefSeq (білок)
NP_006280
NP_035732
Локус (UCSC) Хр. 9: 35.7 – 35.73 Mb Хр. 4: 43.53 – 43.56 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Талін-1 (англ. Talin 1) – білок, який кодується геном TLN1, розташованим у людей на короткому плечі 9-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 2 541 амінокислот, а молекулярна маса — 269 767[4].

Послідовність амінокислот
1020304050
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLF
LSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTI
MVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKEEITGTLRKDKT
LLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYS
DQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPH
NEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQE
WNLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
KKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQYNRVGKVEHGSVALP
AIMRSGASGPENFQVGSMPPAQQQITSGQMHRGHMPPLTSAQQALTGTIN
SSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESKHEIHSQVDAI
TAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGE
LLQQIGESDTDPHFQDALMQLAKAVASAAAALVLKAKSVAQRTEDSGLQT
QVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGC
VSASQAATEDGQLLRGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQ
ATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGESDL
ENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQP
LLVQSCKAVAEQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKM
VAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEM
DSALSVVQNLEKDLQEVKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSS
AIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAALTSDPAVQAI
VLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLN
QAATELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQ
VVSNLKGISMSSSKLLLAAKALSTDPAAPNLKSQLAAAARAVTDSINQLI
TMCTQQAPGQKECDNALRELETVRELLENPVQPINDMSYFGCLDSVMENS
KVLGEAMTGISQNAKNGNLPEFGDAISTASKALCGFTEAAAQAAYLVGVS
DPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAK
HTSALCNSCRLASARTTNPTAKRQFVQSAKEVANSTANLVKTIKALDGAF
TEENRAQCRAATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIV
ISAKTMLESAGGLIQTARALAVNPRDPPSWSVLAGHSRTVSDSIKKLITS
MRDKAPGQLECETAIAALNSCLRDLDQASLAAVSQQLAPREGISQEALHT
QMLTAVQEISHLIEPLANAARAEASQLGHKVSQMAQYFEPLTLAAVGAAS
KTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAV
QMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSF
VDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASEA
KPAAVAAENEEIGSHIKHRVQELGHGCAALVTKAGALQCSPSDAYTKKEL
IECARRVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFAT
AGTLNREGTETFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQS
SVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKA
AAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATT
EHIRQELAVFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQED
VIATANLSRRAIADMLRACKEAAYHPEVAPDVRLRALHYGRECANGYLEL
LDHVLLTLQKPSPELKQQLTGHSKRVAGSVTELIQAAEAMKGTEWVDPED
PTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFEEQILEAAK
SIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMV
AAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDS
EAMKRLQAAGNAVKRASDNLVKAAQKAAAFEEQENETVVVKEKMVGGIAQ
IIAAQEEMLRKERELEEARKKLAQIRQQQYKFLPSELRDEH

Задіяний у такому біологічному процесі як взаємодія хазяїн-вірус. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних контактах, клітинних відростках.

Література[ред. | ред. код]

  • Ben-Yosef T., Francomano C.A. (1999). Characterization of the human talin (TLN) gene: genomic structure, chromosomal localization, and expression pattern.. Genomics 62: 316 — 319.  PubMed DOI:10.1006/geno.1999.6019
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Luo G., Herrera A.H., Horowits R. (1999). Molecular interactions of N-RAP, a nebulin-related protein of striated muscle myotendon junctions and intercalated disks.. Biochemistry 38: 6135 — 6143.  PubMed DOI:10.1021/bi982395t
  • Ling K., Doughman R.L., Firestone A.J., Bunce M.W., Anderson R.A. (2002). Type I gamma phosphatidylinositol phosphate kinase targets and regulates focal adhesions.. Nature 420: 89 — 93.  PubMed DOI:10.1038/nature01082
  • Sun N., Critchley D.R., Paulin D., Li Z., Robson R.M. (2008). Identification of a repeated domain within mammalian alpha-synemin that interacts directly with talin.. Exp. Cell Res. 314: 1839 — 1849.  PubMed DOI:10.1016/j.yexcr.2008.01.034
  • Izard T., Vonrhein C. (2004). Structural basis for amplifying vinculin activation by talin.. J. Biol. Chem. 279: 27667 — 27678.  PubMed DOI:10.1074/jbc.M403076200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11845 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, Q9Y490 (англ.). Процитовано 30 січня 2017. 

Див. також[ред. | ред. код]