NEFM

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NEFM
Ідентифікатори
Символи NEFM, NEF3, NF-M, NFM, neurofilament, medium polypeptide, neurofilament medium
Зовнішні ІД OMIM: 162250 HomoloGene: 38041 GeneCards: NEFM
Шаблон експресії
PBB GE NEFM 205113 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005382
NM_001105541
н/д
RefSeq (білок)
NP_001099011
NP_005373
н/д
Локус (UCSC) Хр. 8: 24.91 – 24.92 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

NEFM (англ. Neurofilament medium) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 916 амінокислот, а молекулярна маса — 102 472[3].

Послідовність амінокислот
1020304050
MSYTLDSLGNPSAYRRVTETRSSFSRVSGSPSSGFRSQSWSRGSPSTVSS
SYKRSMLAPRLAYSSAMLSSAESSLDFSQSSSLLNGGSGPGGDYKLSRSN
EKEQLQGLNDRFAGYIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAY
DQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTE
AAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNHEEEVADLLAQIQ
ASHITVERKDYLKTDISTALKEIRSQLESHSDQNMHQAEEWFKCRYAKLT
EAAEQNKEAIRSAKEEIAEYRRQLQSKSIELESVRGTKESLERQLSDIEE
RHNHDLSSYQDTIQQLENELRGTKWEMARHLREYQDLLNVKMALDIEIAA
YRKLLEGEETRFSTFAGSITGPLYTHRPPITISSKIQKPKVEAPKLKVQH
KFVEEIIEETKVEDEKSEMEEALTAITEELAVSMKEEKKEAAEEKEEEPE
AEEEEVAAKKSPVKATAPEVKEEEGEKEEEEGQEEEEEEDEGAKSDQAEE
GGSEKEGSSEKEEGEQEEGETEAEAEGEEAEAKEEKKVEEKSEEVATKEE
LVADAKVEKPEKAKSPVPKSPVEEKGKSPVPKSPVEEKGKSPVPKSPVEE
KGKSPVPKSPVEEKGKSPVSKSPVEEKAKSPVPKSPVEEAKSKAEVGKGE
QKEEEEKEVKEAPKEEKVEKKEEKPKDVPEKKKAESPVKEEAVAEVVTIT
KSVKVHLEKETKEEGKPLQQEKEKEKAGGEGGSEEEGSDKGAKGSRKEDI
AVNGEVEGKEEVEQETKEKGSGREEEKGVVTNGLDLSPADEKKGGDKSEE
KVVVTKTVEKITSEGGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKV
EKVTSHAIVKEVTQSD

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Myers M.W., Lazzarini R.A., Lee V.M.-Y., Schlaepfer W.W., Nelson D.L. (1987). The human mid-size neurofilament subunit: a repeated protein sequence and the relationship of its gene to the intermediate filament gene family.. EMBO J. 6: 1617 — 1626.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:7734 (англ.). Процитовано 7 вересня 2017. 
  3. UniProt, P07197 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]