TMOD4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TMOD4
Ідентифікатори
Символи TMOD4, SK-TMOD, tropomodulin 4
Зовнішні ІД OMIM: 605834 MGI: 1355285 HomoloGene: 8355 GeneCards: TMOD4
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_013353
NM_016712
RefSeq (білок)
NP_037485
NP_057921
Локус (UCSC) Хр. 1: 151.17 – 151.18 Mb Хр. 3: 95.12 – 95.13 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TMOD4 (англ. Tropomodulin 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 345 амінокислот, а молекулярна маса — 39 335[4].

Послідовність амінокислот
1020304050
MSSYQKELEKYRDIDEDEILRTLSPEELEQLDCELQEMDPENMLLPAGLR
QRDQTKKSPTGPLDREALLQYLEQQALEVKERDDLVPFTGEKKGKPYIQP
KREIPAEEQITLEPELEEALAHATDAEMCDIAAILDMYTLMSNKQYYDAL
CSGEICNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEV
NLNNIQDIPIPMLSELCEAMKANTYVRSFSLVATRSGDPIANAVADMLRE
NRSLQSLNIESNFISSTGLMAVLKAVRENATLTELRVDNQRQWPGDAVEM
EMATVLEQCPSIVRFGYHFTQQGPRARAAQAMTRNNELRRQQKKR

Задіяний у таких біологічних процесах як поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою актину. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Almenar-Queralt A., Lee A., Conley C.A., Ribas de Pouplana L., Fowler V.M. (1999). Identification of a novel tropomodulin isoform, skeletal tropomodulin, that caps actin filament pointed ends in fast skeletal muscle.. J. Biol. Chem. 274: 28466 — 28475.  PubMed DOI:10.1074/jbc.274.40.28466
  • Cox P.R., Zoghbi H.Y. (2000). Sequencing, expression analysis, and mapping of three unique human tropomodulin genes and their mouse orthologs.. Genomics 63: 97 — 107.  PubMed DOI:10.1006/geno.1999.6061
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11874 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q9NZQ9 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]