TNNT2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TNNT2
Protein TNNT2 PDB 1j1d.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TNNT2, CMD1D, CMH2, CMPD2, LVNC6, RCM3, TnTC, cTnT, troponin T2, cardiac type
Зовнішні ІД OMIM: 191045 MGI: 104597 HomoloGene: 68050 GeneCards: TNNT2
Пов'язані генетичні захворювання
hypertrophic cardiomyopathy 2, dilated cardiomyopathy 1D[1]
Шаблон експресії
PBB GE TNNT2 215389 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 1: 201.36 – 201.38 Mb Хр. 1: 135.84 – 135.85 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TNNT2 (англ. Troponin T2, cardiac type) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 298 амінокислот, а молекулярна маса — 35 924[5].

Послідовність амінокислот
1020304050
MSDIEEVVEEYEEEEQEEAAVEEEEDWREDEDEQEEAAEEDAEAEAETEE
TRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDI
HRKRMEKDLNELQALIEAHFENRKKEEEELVSLKDRIERRRAERAEQQRI
RNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSNMMHFGGYIQK
QAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSI
YNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK

Кодований геном білок за функціями належить до м'язових білків, фосфопротеїнів. Задіяний у таких біологічних процесах як поліморфізм, ацетиляція.

Література[ред. | ред. код]

  • Townsend P.J., Barton P.J.R., Yacoub M.H., Farza H. (1995). Molecular cloning of human cardiac troponin T isoforms: expression in developing and failing heart.. J. Mol. Cell. Cardiol. 27: 2223 — 2236.  PubMed DOI:10.1016/S0022-2828(95)91587-7
  • Gerull B., Osterziel K.-J., Witt C., Dietz R., Thierfelder L. (1998). A rapid protocol for cardiac troponin T gene mutation detection in familial hypertrophic cardiomyopathy.. Hum. Mutat. 11: 179 — 182.  PubMed DOI:10.1002/(SICI)1098-1004(1998)11:2<179::AID-HUMU12>3.0.CO;2-W
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Takeda S., Yamashita A., Maeda K., Maeda Y. (2003). Structure of the core domain of human cardiac troponin in the Ca(2+)-saturated form.. Nature 424: 35 — 41.  PubMed DOI:10.1038/nature01780

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]