Профілін-1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Профілін-1
Protein PFN1 PDB 1awi.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PFN1, ALS18, Profilin 1
Зовнішні ІД MGI: 97549 HomoloGene: 3684 GeneCards: PFN1
Шаблон експресії
PBB GE PFN1 200634 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005022
NM_011072
RefSeq (білок)
NP_005013
NP_035202
Локус (UCSC) Хр. 17: 4.95 – 4.95 Mb Хр. 11: 70.65 – 70.65 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Профілін-1 (англ. Profilin 1) – білок, який кодується геном PFN1, розташованим у людей на короткому плечі 17-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 140 амінокислот, а молекулярна маса — 15 054[4].

Послідовність амінокислот
1020304050
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGV
LVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFN
VTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY

Білок має сайт для зв'язування з молекулою актину. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Ampe C., Markey F., Lindberg U., Vandekerckhove J. (1988). The primary structure of human platelet profilin: reinvestigation of the calf spleen profilin sequence.. FEBS Lett. 228: 17 — 21.  PubMed DOI:10.1016/0014-5793(88)80575-1
  • Gieselmann R., Kwiatkowski D.J., Janmey P.A., Witke W. (1995). Distinct biochemical characteristics of the two human profilin isoforms.. Eur. J. Biochem. 229: 621 — 628.  PubMed DOI:10.1111/j.1432-1033.1995.tb20506.x
  • Stueven T., Hartmann E., Goerlich D. (2003). Exportin 6: a novel nuclear export receptor that is specific for profilin.actin complexes.. EMBO J. 22: 5928 — 5940.  PubMed DOI:10.1093/emboj/cdg565
  • Shao J., Welch W.J., Diprospero N.A., Diamond M.I. (2008). Phosphorylation of profilin by ROCK1 regulates polyglutamine aggregation.. Mol. Cell. Biol. 28: 5196 — 5208.  PubMed DOI:10.1128/MCB.00079-08
  • Mahoney N.M., Janmey P.A., Almo S.C. (1997). Structure of the profilin-poly-L-proline complex involved in morphogenesis and cytoskeletal regulation.. Nat. Struct. Biol. 4: 953 — 960.  PubMed DOI:10.1038/nsb1197-953

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:8881 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, P07737 (англ.). Процитовано 30 січня 2017. 

Див. також[ред. | ред. код]