MYLIP

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYLIP
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MYLIP, IDOL, MIR, myosin regulatory light chain interacting protein
Зовнішні ІД OMIM: 610082 MGI: 2388271 HomoloGene: 8309 GeneCards: MYLIP
Шаблон експресії
PBB GE MYLIP 220319 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_013262
NM_153789
RefSeq (білок)
NP_037394
NP_722484
Локус (UCSC) Хр. 6: 16.13 – 16.15 Mb Хр. 13: 45.39 – 45.41 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYLIP (англ. Myosin regulatory light chain interacting protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 445 амінокислот, а молекулярна маса — 49 910[4].

Послідовність амінокислот
1020304050
MLCYVTRPDAVLMEVEVEAKANGEDCLNQVCRRLGIIEVDYFGLQFTGSK
GESLWLNLRNRISQQMDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHI
KEALLAGHLLCSPEQAVELSALLAQTKFGDYNQNTAKYNYEELCAKELSS
ATLNSIVAKHKELEGTSQASAEYQVLQIVSAMENYGIEWHSVRDSEGQKL
LIGVGPEGISICKDDFSPINRIAYPVVQMATQSGKNVYLTVTKESGNSIV
LLFKMISTRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDLKGHLASLF
LNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRNNQSPSHSP
LKSSESSMNCSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFC
PCGHTVCCESCAAQLQSCPVCRSRVEHVQHVYLPTHTSLLNLTVI

Кодований геном білок за функцією належить до трансфераз. Задіяний у таких біологічних процесах, як убіквітинування білків, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, іоном заліза. Локалізований у клітинній мембрані, цитоплазмі, мембрані.

Література[ред. | ред. код]

  • Olsson P.-A., Korhonen L., Mercer E.A., Lindholm D. (1999). MIR is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowth.. J. Biol. Chem. 274: 36288 — 36292.  PubMed DOI:10.1074/jbc.274.51.36288
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bornhauser B.C., Johansson C., Lindholm D. (2003). Functional activities and cellular localization of the ezrin, radixin, moesin (ERM) and RING zinc finger domains in MIR.. FEBS Lett. 553: 195 — 199.  PubMed DOI:10.1016/S0014-5793(03)01010-X
  • Bornhauser B.C., Olsson P.-A., Lindholm D. (2003). MSAP is a novel MIR-interacting protein that enhances neurite outgrowth and increases myosin regulatory light chain.. J. Biol. Chem. 278: 35412 — 35420.  PubMed DOI:10.1074/jbc.M306271200
  • Zelcer N., Hong C., Boyadjian R., Tontonoz P. (2009). LXR regulates cholesterol uptake through Idol-dependent ubiquitination of the LDL receptor.. Science 325: 100 — 104.  PubMed DOI:10.1126/science.1168974

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:21155 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q8WY64 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]