MYO6

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYO6
Protein MYO6 PDB 2bkh.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MYO6, DFNA22, DFNB37, myosin VI, Myo6-008, Myo6-007
Зовнішні ІД OMIM: 600970 MGI: 104785 HomoloGene: 56417 GeneCards: MYO6
Пов'язані генетичні захворювання
autosomal recessive nonsyndromic deafness 37, nonsyndromic deafness[1]
Шаблон експресії
PBB GE MYO6 210480 s at fs.png

PBB GE MYO6 203216 s at fs.png

PBB GE MYO6 203215 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001039546
NM_008662
RefSeq (білок)
н/д
Локус (UCSC) Хр. 6: 75.75 – 75.92 Mb Хр. 9: 80.17 – 80.31 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYO6 (англ. Myosin VI) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 294 амінокислот, а молекулярна маса — 149 691[5].

Послідовність амінокислот
1020304050
MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFP
AEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPY
FDIPKIYSSEAIKSYQGKSLGTRPPHVFAIADKAFRDMKVLKMSQSIIVS
GESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLLEAFGNAKTVRN
NNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYR
LCAGASEDIREKLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEY
LKAGSMKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNI
DFEEAGSTSGGCNLKNKSAQSLEYCAELLGLDQDDLRVSLTTRVMLTTAG
GTKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSY
FIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEG
LGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPSDQHFTSAVHQK
HKDHFRLTIPRKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDA
LHMSLESLICESRDKFIRELFESSTNNNKDTKQKAGKLSFISVGNKFKTQ
LNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDL
MQGGYPSRASFHELYNMYKKYMPDKLARLDPRLFCKALFKALGLNENDYK
FGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNHWLTCSRWKKVQWCS
LSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGLVKVGTLKKRL
DKFNEVVSVLKDGKPEMNKQIKNLEISIDTLMAKIKSTMMTQEQIQKEYD
ALVKSSEELLSALQKKKQQEEEAERLRRIQEEMEKERKRREEDEKRRRKE
EEERRMKLEMEAKRKQEEEERKKREDDEKRIQAEVEAQLARQKEEESQQQ
AVLEQERRDRELALRIAQSEAELISDEAQADLALRRSLDSYPVSKNDGTR
PKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINT
SCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYDFAP
FLNNSPQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQYKDPQSKKKG
WWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRG
AEILPRQFEEIWERCGGIQYLQNAIESRQARPTYATAMLQSLLK

Кодований геном білок за функціями належить до білкових моторів, міозинів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт, транспорт білків, ендоцитоз, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою актину, молекулою кальмодуліну. Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані, клатрин-вкритих заглибинах мембрани, клітинних відростках, цитоплазматичних везикулах, апараті гольджі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Buss F., Arden S.D., Lindsay M., Luzio J.P., Kendrick-Jones J. (2001). Myosin VI isoform localized to clathrin-coated vesicles with a role in clathrin-mediated endocytosis.. EMBO J. 20: 3676 — 3684.  PubMed DOI:10.1093/emboj/20.14.3676
  • Jung E.J., Liu G., Zhou W., Chen X. (2006). Myosin VI is a mediator of the p53-dependent cell survival pathway.. Mol. Cell. Biol. 26: 2175 — 2186.  PubMed DOI:10.1128/MCB.26.6.2175-2186.2006
  • Spink B.J., Sivaramakrishnan S., Lipfert J., Doniach S., Spudich J.A. (2008). Long single alpha-helical tail domains bridge the gap between structure and function of myosin VI.. Nat. Struct. Mol. Biol. 15: 591 — 597.  PubMed DOI:10.1038/nsmb.1429

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]