SPTA1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SPTA1
Protein SPTA1 PDB 1owa.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SPTA1, EL2, HPP, HS3, SPH3, SPTA, Spectrin, alpha 1, spectrin alpha, erythrocytic 1
Зовнішні ІД OMIM: 182860 MGI: 98385 HomoloGene: 74460 GeneCards: SPTA1
Пов'язані генетичні захворювання
hereditary spherocytosis type 3[1]
Шаблон експресії
PBB GE SPTA1 206937 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003126
NM_011465
RefSeq (білок)
NP_003117
NP_035595
Локус (UCSC) Хр. 1: 158.61 – 158.69 Mb Хр. 1: 174.17 – 174.25 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SPTA1 (англ. Spectrin alpha, erythrocytic 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 2 419 амінокислот, а молекулярна маса — 280 014[5].

Послідовність амінокислот
1020304050
MEQFPKETVVESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLE
DSYHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAE
VQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEK
GDQLLRALKFQQYVQECADILEWIGDKEAIATSVELGEDWERTEVLHKKF
EDFQVELVAKEGRVVEVNQYANECAEENHPDLPLIQSKQNEVNAAWERLR
GLALQRQKALSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASE
GLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDLVS
SWEHIRALATSRYEKLQATYWYHRFSSDFDELSGWMNEKTAAINADELPT
DVAGGEVLLDRHQQHKHEIDSYDDRFQSADETGQDLVNANHEASDEVREK
MEILDNNWTALLELWDERHRQYEQCLDFHLFYRDSEQVDSWMSRQEAFLE
NEDLGNSLGSAEALLQKHEDFEEAFTAQEEKIITVDKTATKLIGDDHYDS
ENIKAIRDGLLARRDALREKAATRRRLLKESLLLQKLYEDSDDLKNWINK
KKKLADDEDYKDIQNLKSRVQKQQVFEKELAVNKTQLENIQKTGQEMIEG
GHYASDNVTTRLSEVASLWEELLEATKQKGTQLHEANQQLQFENNAEDLQ
RWLEDVEWQVTSEDYGKGLAEVQNRLRKHGLLESAVAARQDQVDILTDLA
AYFEEIGHPDSKDIRARQESLVCRFEALKEPLATRKKKLLDLLHLQLICR
DTEDEEAWIQETEPSATSTYLGKDLIASKKLLNRHRVILENIASHEPRIQ
EITERGNKMVEEGHFAAEDVASRVKSLNQNMESLRARAARRQNDLEANVQ
FQQYLADLHEAETWIREKEPIVDNTNYGADEEAAGALLKKHEAFLLDLNS
FGDSMKALRNQANACQQQQAAPVEGVAGEQRVMALYDFQARSPREVTMKK
GDVLTLLSSINKDWWKVEAADHQGIVPAVYVRRLAHDEFPMLPQRRREEP
GNITQRQEQIENQYRSLLDRAEERRRRLLQRYNEFLLAYEAGDMLEWIQE
KKAENTGVELDDVWELQKKFDEFQKDLNTNEPRLRDINKVADDLLFEGLL
TPEGAQIRQELNSRWGSLQRLADEQRQLLGSAHAVEVFHREADDTKEQIE
KKCQALSAADPGSDLFSVQALQRRHEGFERDLVPLGDKVTILGETAERLS
ESHPDATEDLQRQKMELNEAWEDLQGRTKDRKESLNEAQKFYLFLSKARD
LQNWISSIGGMVSSQELAEDLTGIEILLERHQEHRADMEAEAPTFQALED
FSAELIDSGHHASPEIEKKLQAVKLERDDLEKAWEKRKKILDQCLELQMF
QGNCDQVESWMVARENSLRSDDKSSLDSLEALMKKRDDLDKAITAQEGKI
TDLEHFAESLIADEHYAKEEIATRLQRVLDRWKALKAQLIDERTKLGDYA
NLKQFYRDLEELEEWISEMLPTACDESYKDATNIQRKYLKHQTFAHEVDG
RSEQVHGVINLGNSLIECSACDGNEEAMKEQLEQLKEHWDHLLERTNDKG
KKLNEASRQQRFNTSIRDFEFWLSEAETLLAMKDQARDLASAGNLLKKHQ
LLEREMLAREDALKDLNTLAEDLLSSGTFNVDQIVKKKDNVNKRFLNVQE
LAAAHHEKLKEAYALFQFFQDLDDEESWIEEKLIRVSSQDYGRDLQGVQN
LLKKHKRLEGELVAHEPAIQNVLDMAEKLKDKAAVGQEEIQLRLAQFVEH
WEKLKELAKARGLKLEESLEYLQFMQNAEEEEAWINEKNALAVRGDCGDT
LAATQSLLMKHEALENDFAVHETRVQNVCAQGEDILNKVLQEESQNKEIS
SKIEALNEKTPSLAKAIAAWKLQLEDDYAFQEFNWKADVVEAWIADKETS
LKTNGNGADLGDFLTLLAKQDTLDASLQSFQQERLPEITDLKDKLISAQH
NQSKAIEERYAALLKRWEQLLEASAVHRQKLLEKQLPLQKAEDLFVEFAH
KASALNNWCEKMEENLSEPVHCVSLNEIRQLQKDHEDFLASLARAQADFK
CLLELDQQIKALGVPSSPYTWLTVEVLERTWKHLSDIIEEREQELQKEEA
RQVKNFEMCQEFEQNASTFLQWILETRAYFLDGSLLKETGTLESQLEANK
RKQKEIQAMKRQLTKIVDLGDNLEDALILDIKYSTIGLAQQWDQLYQLGL
RMQHNLEQQIQAKDIKGVSEETLKEFSTIYKHFDENLTGRLTHKEFRSCL
RGLNYYLPMVEEDEHEPKFEKFLDAVDPGRKGYVSLEDYTAFLIDKESEN
IKSSDEIENAFQALAEGKSYITKEDMKQALTPEQVSFCATHMQQYMDPRG
RSHLSGYDYVGFTNSYFGN

Кодований геном білок за функціями належить до кепінгів актину, фосфопротеїнів. Задіяний у таких біологічних процесах як пдтримання форми клітини, поліморфізм. Білок має сайт для зв'язування з молекулою актину, іонами металів, іоном кальцію. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Linnenbach A.J., Speicher D.W., Marchesi V.T., Forget B.G. (1986). Cloning of a portion of the chromosomal gene for human erythrocyte alpha-spectrin by using a synthetic gene fragment.. Proc. Natl. Acad. Sci. U.S.A. 83: 2397 — 2401.  PubMed DOI:10.1073/pnas.83.8.2397
  • Speicher D.W., Marchesi V.T. (1984). Erythrocyte spectrin is comprised of many homologous triple helical segments.. Nature 311: 177 — 180.  PubMed DOI:10.1038/311177a0
  • Voss M., Lettau M., Janssen O. (2009). Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.. BMC Immunol. 10: 53 — 53.  PubMed DOI:10.1186/1471-2172-10-53
  • Park S., Caffrey M.S., Johnson M.E., Fung L.W.-M. (2003). Solution structural studies on human erythrocyte alpha-spectrin tetramerization site.. J. Biol. Chem. 278: 21837 — 21844.  PubMed DOI:10.1074/jbc.M300617200
  • Maillet P., Alloisio N., Morle L., Delaunay J. (1996). Spectrin mutations in hereditary elliptocytosis and hereditary spherocytosis.. Hum. Mutat. 8: 97 — 107.  PubMed DOI:10.1002/(SICI)1098-1004(1996)8:2<97::AID-HUMU1>3.3.CO;2-W
  • Speicher D.W., Davis G., Marchesi V.T. (1983). Structure of human erythrocyte spectrin. II. The sequence of the alpha-I domain.. J. Biol. Chem. 258: 14938 — 14947.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]