WAS

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
WASP actin nucleation promoting factor
Ідентифікатори
Символи WASwiskott-Aldrich syndrome proteinuniprot:P42768eczema-thrombocytopeniathrombocytopenia 1 (X-linked)
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE WAS 38964 r at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

WAS (англ. Wiskott-Aldrich syndrome) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі X-хромосоми.[1] Довжина поліпептидного ланцюга білка становить 502 амінокислот, а молекулярна маса — 52 913[2].

Послідовність амінокислот
1020304050
MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAV
VQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQE
LYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQ
RQSGDRRQLPPPPTPANEERRGGLPPLPLHPGGDQGGPPVGPLSLGLATV
DIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGAPSGFKHVSHV
GWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIA
PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPP
PPPPSSGNGPAPPPLPPALVPAGGLAPGGGRGALLDQIRQGIQLNKTPGA
PESSALQPPPQSSEGLVGALMHVMQKRSRAIHSSDEGEDQAGDEDEDDEW
DD

Кодований геном білок за функцією належить до фосфопротеїнів. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Derry J.M.J., Ochs H.D., Francke U. (1994). Isolation of a novel gene mutated in Wiskott-Aldrich syndrome.. Cell 78: 635 — 644.  PubMed DOI:10.1016/0092-8674(94)90528-2
  • Kwan S.-P., Hagemann T.L., Radtke B.E., Blaese R.M., Rosen F.S. (1995). Identification of mutations in the Wiskott-Aldrich syndrome gene and characterization of a polymorphic dinucleotide repeat at DXS6940, adjacent to the disease gene.. Proc. Natl. Acad. Sci. U.S.A. 92: 4706 — 4710.  PubMed DOI:10.1073/pnas.92.10.4706
  • Hagemann T.L., Kwan S.-P. (1999). The identification and characterization of two promoters and the complete genomic sequence for the Wiskott-Aldrich syndrome gene.. Biochem. Biophys. Res. Commun. 256: 104 — 109.  PubMed DOI:10.1006/bbrc.1999.0292
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kolluri R., Tolias K.F., Carpenter C.L., Rosen F.S., Kirchhausen T. (1996). Direct interaction of the Wiskott-Aldrich syndrome protein with the GTPase Cdc42.. Proc. Natl. Acad. Sci. U.S.A. 93: 5615 — 5618.  PubMed DOI:10.1073/pnas.93.11.5615
  • Ramesh N., Anton I.M., Hartwig J.H., Geha R.S. (1997). WIP, a protein associated with Wiskott-Aldrich syndrome protein, induces actin polymerization and redistribution in lymphoid cells.. Proc. Natl. Acad. Sci. U.S.A. 94: 14671 — 14676.  PubMed DOI:10.1073/pnas.94.26.14671

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:12731 (англ.). Процитовано 12 вересня 2017. 
  2. UniProt, P42768 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]