SPTBN2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SPTBN2
Protein SPTBN2 PDB 1wjm.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SPTBN2, GTRAP41, SCA5, SCAR14, spectrin beta, non-erythrocytic 2
Зовнішні ІД OMIM: 604985 MGI: 1313261 HomoloGene: 48482 GeneCards: SPTBN2
Пов'язані генетичні захворювання
spinocerebellar ataxia type 5, autosomal recessive spinocerebellar ataxia 14[1]
Шаблон експресії
PBB GE SPTBN2 205155 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006946
NM_021287
RefSeq (білок)
NP_008877
NP_067262
Локус (UCSC) Хр. 11: 66.69 – 66.73 Mb Хр. 19: 4.71 – 4.75 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SPTBN2 (англ. Spectrin beta, non-erythrocytic 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 2 390 амінокислот, а молекулярна маса — 271 325[5].

Послідовність амінокислот
1020304050
MSSTLSPTDFDSLEIQGQYSDINNRWDLPDSDWDNDSSSARLFERSRIKA
LADEREAVQKKTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSG
EILPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTL
GLVWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHN
FTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLAEKELGL
TKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHA
MEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSY
RTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWE
RLEKAEHERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQ
DNFGLELAAVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAAERYHDIK
RIAARQHNVARLWDFLRQMVAARRERLLLNLELQKVFQDLLYLMDWMEEM
KGRLQSQDLGRHLAGVEDLLQLHELVEADIAVQAERVRAVSASALRFCNP
GKEYRPCDPQLVSERVAKLEQSYEALCELAAARRARLEESRRLWRFLWEV
GEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLT
LEQGQQLVAEGHPGASQASARAAELQAQWERLEALAEERAQRLAQAASLY
QFQADANDMEAWLVDALRLVSSPELGHDEFSTQALARQHRALEEEIRSHR
PTLDALREQAAALPPTLSRTPEVQSRVPTLERHYEELQARAGERARALEA
ALALYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPE
MNTLAAQITAVNDIAEQLLKANPPGKDRIVNTQEQLNHRWQQFRRLADGK
KAALTSALSIQNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRK
LAGTERDLEAIAARVGELTREANALAAGHPAQAVAINARLREVQTGWEDL
RATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEA
EALLAQHAALRGEVERAQSEYSRLRALGEEVTRDQADPQCLFLRQRLEAL
GTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEM
PGTLQAADAAIKKLEDFMSTMDANGERIHGLLEAGRQLVSEGNIHADKIR
EKADSIERRHKKNQDAAQQFLGRLRDNREQQHFLQDCHELKLWIDEKMLT
AQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPEL
KALVSEKLRDLHRRWDELETTTQAKARSLFDANRAELFAQSCCALESWLE
SLQAQLHSDDYGKDLTSVNILLKKQQMLEWEMAVREKEVEAIQAQAKALA
QEDQGAGEVERTSRAVEEKFRALCQPMRERCRRLQASREQHQFHRDVEDE
ILWVTERLPMASSMEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADLRER
QRALGAAAAGPELAELQEMWKRLGHELELRGKRLEDALRAQQFYRDAAEA
EAWMGEQELHMMGQEKAKDELSAQAEVKKHQVLEQALADYAQTIHQLAAS
SQDMIDHEHPESTRISIRQAQVDKLYAGLKELAGERRERLQEHLRLCQLR
RELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSRDTSTIGQER
VDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAA
YELQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQ
ALSPQVQQVQDDGHRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARR
QLLLDTTDKFRFFKAVRELMLWMDEVNLQMDAQERPRDVSSADLVIKNQQ
GIKAEIEARADRFSSCIDMGKELLARSHYAAEEISEKLSQLQARRQETAE
KWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVES
LIKRHEAFQKSAVAWEERFCALEKLTALEEREKERKRKREEEERRKQPPA
PEPTASVPPGDLVGGQTASDTTWDGTQPRPPPSTQAPSVNGVCTDGEPSQ
PLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRGPAPSAMPQSRST
ESAHAATLPPRGPEPSAQEQMEGMLCRKQEMEAFGKKAANRSWQNVYCVL
RRGSLGFYKDAKAASAGVPYHGEVPVSLARAQGSVAFDYRKRKHVFKLGL
QDGKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEPVVPSTTRGMT
RAMTMPPVSPVGAEGPVVLRSKDGREREREKRFSFFKKNK

Кодований геном білок за функціями належить до кепінгів актину, фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою актину. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Jacob F.D., Ho E.S., Martinez-Ojeda M., Darras B.T., Khwaja O.S. (2013). Case of infantile onset spinocerebellar ataxia type 5.. J. Child Neurol. 28: 1292 — 1295.  PubMed DOI:10.1177/0883073812454331

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]