Гелсолін

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Гелсолін
Protein GSN PDB 1c0f.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GSN, Gsn, ADF, AGEL, gelsolin
Зовнішні ІД OMIM: 137350 MGI: 95851 HomoloGene: 147 GeneCards: GSN
Шаблон експресії
PBB GE GSN 214040 s at fs.png

PBB GE GSN 200696 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) н/д Хр. 2: 35.26 – 35.31 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Гелсолін (англ. Gelsolin) – білок, який кодується геном GSN, розташованим у людей на короткому плечі 9-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 782 амінокислот, а молекулярна маса — 85 698[4].

Послідовність амінокислот
1020304050
MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPN
SMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKT
VQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQ
GFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRA
TEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDN
ERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKL
YKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQA
NTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPD
QTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIW
RIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQ
DEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGG
TSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPS
AAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAA
YRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVML
LDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQG
FEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA

Цей білок за функцією належить до кепінгів актину. Задіяний у такому біологічному процесі як біогенез та деградація війок. Білок має сайт для зв'язування з молекулою актину, іонами металів, іоном кальцію. Локалізований у цитоплазмі, цитоскелеті. Також секретований назовні.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Maury C.P.J., Alli K., Baumann M. (1990). Finnish hereditary amyloidosis. Amino acid sequence homology between the amyloid fibril protein and human plasma gelsoline.. FEBS Lett. 260: 85 — 87.  PubMed DOI:10.1016/0014-5793(90)80072-Q
  • Allen P.G. (1997). Functional consequences of disulfide bond formation in gelsolin.. FEBS Lett. 401: 89 — 94.  PubMed DOI:10.1016/S0014-5793(96)01439-1
  • McLaughlin P.J., Gooch J.T., Mannherz H.-G., Weeds A.G. (1993). Structure of gelsolin segment 1-actin complex and the mechanism of filament severing.. Nature 364: 685 — 692.  PubMed DOI:10.1038/364685a0
  • Xian W., Vegners R., Janmey P.A., Braunlin W.H. (1995). Spectroscopic studies of a phosphoinositide-binding peptide from gelsolin: behavior in solutions of mixed solvent and anionic micelles.. Biophys. J. 69: 2695 — 2702.  PubMed DOI:10.1016/S0006-3495(95)80140-2
  • Ghiso J., Haltia M., Prelli F., Novello J., Frangione B. (1990). Gelsolin variant (Asn-187) in familial amyloidosis, Finnish type.. Biochem. J. 272: 827 — 830.  PubMed DOI:10.1042/bj2720827

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4620 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, P06396 (англ.). Процитовано 30 січня 2017. 

Див. також[ред. | ред. код]