SPTAN1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SPTAN1
Protein SPTAN1 PDB 1aey.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SPTAN1, EIEE5, NEAS, SPTA2, spectrin alpha, non-erythrocytic 1
Зовнішні ІД OMIM: 182810 MGI: 98386 HomoloGene: 2353 GeneCards: SPTAN1
Пов'язані генетичні захворювання
undetermined early-onset epileptic encephalopathy[1]
Шаблон експресії
PBB GE SPTAN1 215235 at fs.png

PBB GE SPTAN1 208611 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001076554
NM_001177667
NM_001177668
NM_001309460
NM_001369325
RefSeq (білок)
NP_001171138
NP_001171139
NP_001296389
NP_001356254
Локус (UCSC) Хр. 9: 128.55 – 128.63 Mb Хр. 2: 29.97 – 30.03 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SPTAN1 (англ. Spectrin alpha, non-erythrocytic 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 2 472 амінокислот, а молекулярна маса — 284 539[5].

Послідовність амінокислот
1020304050
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ
RDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIV
KLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQK
LVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAA
HEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGK
LFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL
ERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLA
AERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELASDVAGAEALL
DRHQEHKGEIDAHEDSFKSADESGQALLAAGHYASDEVREKLTVLSEERA
ALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLD
SVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDA
LLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEA
YKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVA
ARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGH
LASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHF
DAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWI
REKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAM
VEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADAN
EAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALR
EQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNST
NKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQID
NQTRITKEAGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFREA
NELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDI
NKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVH
TVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIE
EKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLI
QSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDLQRFLSDFRD
LMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQ
FGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLF
HRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK
IAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGES
QTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQSKHQKHQAFEAELH
ANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEK
SQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKH
QLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRDTINGRFQKIK
SMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQ
NLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVE
HWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGD
TLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSK
MKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLK
TDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQ
SKAIEARHASLMKRWSQLLANSAARKKKLLEAQSHFRKVEDLFLTFAKKA
SAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQL
AELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQ
EENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKR
KHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQL
GMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKS
CLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRET
ENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVD
GKGRELPTAFDYVEFTRSLFVN

Кодований геном білок за функцією належить до кепінгів актину. Білок має сайт для зв'язування з молекулою актину, молекулою кальмодуліну, іонами металів, іоном кальцію. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Cianci C.D., Zhang Z., Pradhan D., Morrow J.S. (1999). Brain and muscle express a unique alternative transcript of alphaII spectrin.. Biochemistry 38: 15721 — 15730.  PubMed DOI:10.1021/bi991458k
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • McMahon A.P., Moon R.T. (1987). Structure and evolution of a non-erythroid spectrin, human alpha-fodrin.. Biochem. Soc. Trans. 15: 804 — 807.  PubMed DOI:10.1042/bst0150804
  • Stabach P.R., Cianci C.D., Glantz S.B., Zhang Z., Morrow J.S. (1997). Site-directed mutagenesis of alpha II spectrin at codon 1175 modulates its mu-calpain susceptibility.. Biochemistry 36: 57 — 65.  PubMed DOI:10.1021/bi962034i
  • Lundberg S., Bjoerk J., Loefvenberg L., Backman L. (1995). Cloning, expression and characterization of two putative calcium-binding sites in human non-erythroid alpha-spectrin.. Eur. J. Biochem. 230: 658 — 665.  PubMed DOI:10.1111/j.1432-1033.1995.0658h.x
  • Holaska J.M., Kowalski A.K., Wilson K.L. (2004). Emerin caps the pointed end of actin filaments: evidence for an actin cortical network at the nuclear inner membrane.. PLoS Biol. 2: 1354 — 1362.  PubMed DOI:10.1371/journal.pbio.0020231

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]