KIF1B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Kinesin family member 1B
Ідентифікатори
Символи kinesin superfamily protein KIF1Bkinesin-like protein KIF1BKIF1B
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

KIF1B (англ. Kinesin family member 1B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 1 816 амінокислот, а молекулярна маса — 204 476[2].

Послідовність амінокислот
1020304050
MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSF
SFDYSYWSHTSPEDPCFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTG
AGKSYTMMGKQEESQAGIIPQLCEELFEKINDNCNEEMSYSVEVSYMEIY
CERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGN
KARTVAATNMNETSSRSHAVFTIVFTQKKHDNETNLSTEKVSKISLVDLA
GSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDNCTSKSKKKKK
TDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADR
AKQIKCNAVINEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDIDPLIDD
YSGSGSKYLKDFQNNKHRYLLASENQRPGHFSTASMGSLTSSPSSCSLSS
QVGLTSVTSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKLRKTEA
IRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYY
IKDGITRVGQADAERRQDIVLSGAHIKEEHCIFRSERSNSGEVIVTLEPC
ERSETYVNGKRVSQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSA
ETPSEPVDWTFAQRELLEKQGIDMKQEMEKRLQEMEILYKKEKEEADLLL
EQQRLDYESKLQALQKQVETRSLAAETTEEEEEEEEVPWTQHEFELAQWA
FRKWKSHQFTSLRDLLWGNAVYLKEANAISVELKKKVQFQFVLLTDTLYS
PLPPELLPTEMEKTHEDRPFPRTVVAVEVQDLKNGATHYWSLEKLKQRLD
LMREMYDRAGEMASSAQDESETTVTGSDPFYDRFHWFKLVGSSPIFHGCV
NERLADRTPSPTFSTADSDITELADEQQDEMEDFDDEAFVDDAGSDAGTE
EGSDLFSDGHDPFYDRSPWFILVGRAFVYLSNLLYPVPLIHRVAIVSEKG
EVRGFLRVAVQAIAADEEAPDYGSGIRQSGTAKISFDNEYFNQSDFSSVA
MTRSGLSLEELRIVEGQGQSSEVITPPEEISRINDLDLKSSTLLDGKMVM
EGFSEEIGNHLKLGSAFTFRVTVLQASGILPEYADIFCQFNFLHRHDEAF
STEPLKNNGRGSPLAFYHVQNIAVEITESFVDYIKTKPIVFEVFGHYQQH
PLHLQGQELNSPPQPCRRFFPPPMPLSKPVPATKLNTMSKTSLGQSMSKY
DLLVWFEISELEPTGEYIPAVVDHTAGLPCQGTFLLHQGIQRRITVTIIH
EKGSELHWKDVRELVVGRIRNKPEVDEAAVDAILSLNIISAKYLKSSHNS
SRTFYRFEAVWDSSLHNSLLLNRVTPYGEKIYMTLSAYLELDHCIQPAVI
TKDVCMVFYSRDAKISPPRSLRSLFGSGYSKSPDSNRVTGIYELSLCKMS
DTGSPGMQRRRRKILDTSVAYVRGEENLAGWRPRGDSLILEHQWELEKLE
LLHEVEKTRHFLLLRERLGDSIPKSLSDSLSPSLSSGTLSTSTSISSQIS
TTTFESAITPSESSGYDSGDIESLVDREKELATKCLQLLTHTFNREFSQV
HGSVSDCKLSDISPIGRDPSESSFSSATLTPSSTCPSLVDSRSNSLDQKT
PEANSRASSPCPEFEQFQIVPAVETPYLARAGKNEFLNLVPDIEEIRPSS
VVSKKGYLHFKEPLYSNWAKHFVVVRRPYVFIYNSDKDPVERGIINLSTA
QVEYSEDQQAMVKTPNTFAVCTKHRGVLLQALNDKDMNDWLYAFNPLLAG
TIRSKLSRRCPSQSKY

Кодований геном білок за функціями належить до білкових моторів, фосфопротеїнів. Задіяний у таких біологічних процесах як апоптоз, поліморфізм, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті, мітохондрії, цитоплазматичних везикулах.

Література[ред. | ред. код]

  • Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. (2000). Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.. DNA Res. 7: 143 — 150.  PubMed DOI:10.1093/dnares/7.2.143
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Wozniak M.J., Melzer M., Dorner C., Haring H.U., Lammers R. (2005). The novel protein KBP regulates mitochondria localization by interaction with a kinesin-like protein.. BMC Cell Biol. 6: 35 — 35.  PubMed DOI:10.1186/1471-2121-6-35

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:16636 (англ.). Процитовано 28 серпня 2017. 
  2. UniProt, O60333 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]