MACF1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MACF1
Наявні структури
PDBПошук для людей: PDBe RCSB
Ідентифікатори
Символи MACF1, ABP620, ACF7, MACF, OFC4, microtubule-actin crosslinking factor 1, LIS9, microtubule actin crosslinking factor 1
Зовнішні ІД OMIM: 608271 HomoloGene: 136220 GeneCards: MACF1
Шаблон експресії
PBB GE MACF1 208633 s at fs.png

PBB GE MACF1 208634 s at fs.png

PBB GE MACF1 207358 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_012090
NM_033044
н/д
RefSeq (білок)
NP_036222
н/д
Локус (UCSC) Хр. 1: 39.08 – 39.49 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

MACF1 (англ. Microtubule-actin crosslinking factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [2] Довжина поліпептидного ланцюга білка становить 7 388 амінокислот, а молекулярна маса — 838 308[3].

Послідовність амінокислот
1020304050
MSSSDEETLSERSCRSERSCRSERSYRSERSGSLSPCPPGDTLPWNLPLH
EQKKRKSQDSVLDPAERAVVRVADERDRVQKKTFTKWVNKHLMKVRKHIN
DLYEDLRDGHNLISLLEVLSGIKLPREKGRMRFHRLQNVQIALDFLKQRQ
VKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIYISGESGDMSAKEKL
LLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQIQS
NRENLEQAFEVAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKV
PEGGEGISATEVDSRWQEYQSRVDSLIPWIKQHTILMSDKTFPQNPVELK
ALYNQYIHFKETEILAKEREKGRIEELYKLLEVWIEFGRIKLPQGYHPND
VEEEWGKLIIEMLEREKSLRPAVERLELLLQIANKIQNGALNCEEKLTLA
KNTLQADAAHLESGQPVQCESDVIMYIQECEGLIRQLQVDLQILRDENYY
QLEELAFRVMRLQDELVTLRLECTNLYRKGHFTSLELVPPSTLTTTHLKA
EPLTKATHSSSTSWFRKPMTRAELVAISSSEDEGNLRFVYELLSWVEEMQ
MKLERAEWGNDLPSVELQLETQQHIHTSVEELGSSVKEARLYEGKMSQNF
HTSYAETLGKLETQYCKLKETSSFRMRHLQSLHKFVSRATAELIWLNEKE
EEELAYDWSDNNSNISAKRNYFSELTMELEEKQDVFRSLQDTAELLSLEN
HPAKQTVEAYSAAVQSQLQWMKQLCLCVEQHVKENTAYFQFFSDARELES
FLRNLQDSIKRKYSCDHNTSLSRLEDLLQDSMDEKEQLIQSKSSVASLVG
RSKTIVQLKPRSPDHVLKNTISVKAVCDYRQIEITICKNDECVLEDNSQR
TKWKVISPTGNEAMVPSVCFLIPPPNKDAIEMASRVEQSYQKVMALWHQL
HVNTKSLISWNYLRKDLDLVQTWNLEKLRSSAPGECHQIMKNLQAHYEDF
LQDSRDSVLFSVADRLRLEEEVEACKARFQHLMKSMENEDKEETVAKMYI
SELKNIRLRLEEYEQRVVKRIQSLASSRTDRDAWQDNALRIAEQEHTQED
LQQLRSDLDAVSMKCDSFLHQSPSSSSVPTLRSELNLLVEKMDHVYGLST
VYLNKLKTVDVIVRSIQDAELLVKGYEIKLSQEEVVLADLSALEAHWSTL
RHWLSDVKDKNSVFSVLDEEIAKAKVVAEQMSRLTPERNLDLERYQEKGS
QLQERWHRVIAQLEIRQSELESIQEVLGDYRACHGTLIKWIEETTAQQEM
MKPGQAEDSRVLSEQLSQQTALFAEIERNQTKLDQCQKFSQQYSTIVKDY
ELQLMTYKAFVESQQKSPGKRRRMLSSSDAITQEFMDLRTRYTALVTLTT
QHVKYISDALRRLEEEEKVVEEEKQEHVEKVKELLGWVSTLARNTQGKAT
SSETKESTDIEKAILEQQVLSEELTTKKEQVSEAIKTSQIFLAKHGHKLS
EKEKKQISEQLNALNKAYHDLCDGSANQLQQLQSQLAHQTEQKECRAVAG
VIDLGTVEIFPIFKAMQKGLLDQDTGLVLLESQVIMSGLIAPETGENLSL
EEGIARNLINPQMYQQLRELQDALALISRLTESRGPLSVVEAIEKRIISE
TVGLKILEAHLATGGFSLSPSENCINLEEAFHQGLISAWLHSVLESYLRT
SKNLIDPNTAEKIGLLDLMQRCIVHQESGFKLLPVKQLAGGMVSLKSGRK
VSIFRAVQEGLIDRQVTVRLLEAQLFAGGIVDPRTGHRLTVEEAVRHNLI
DQDMACAILIRQLQTGGIIDTVTGQRLTIDEAVSNDLVAAKIALVILESL
WSFMGLLWPESGEILPITDALEQGIVSTELAHKILSNRQHIKALFLPATT
EILSWKKAIESGILDRDLANNLKSICIPDVMPHMQLADSAEQNINPGAAV
LPCSKSHPKATASQSENLLFQLMTHSYINVQNGQRLLLLDKELMETLTSR
DEYQTSPPKVVEIGHQRQKTPEGLQESANVKISGTFSSGWTVRLPEFQFS
SQNKEYPDREDCTTEKGKKTTVETEDSSVENPEQDLFVEQKERNPNIDAL
KVINKVKLEVQRQLIGTQREDQTAVSVRENASRGHLLTIPPAEAEGVPLV
VDKDVFSVETPKKEHQPLRNTSFTCQNEQAHTLETEYIHDETGGSHIKPQ
SKKLQVQVKKTLGIKLELKSETDGNVHPLDKKEMLKKTFLAKDDHKESQE
AQNIAGGSMMMSEKTDEEDSGREIFLSCSHPLELLEEATLNVLSAQLLDG
GIFHEQTGQKLLLNEAISRGIVPSHTAVKLMEKLNMFQGFFDSQTCESLT
TEEVINEGLMDEKLLHNVLMADKAISGVLDPRTQTLCSVKDAVTVGLLDK
ETATRILERQVVTGGIIDLKRGKKVSVTLASTLGLVDVADQPELINLEKA
SKGRDAEKTVRERLISLQMETTGLIDPDSKAPLTVVQSIDRGLLEREEAV
RLLTKQVVDGGIIHHISGMRLSVDNAFRHGLIGEDLAEKLKRVENLNIHQ
IFNPETKENISLPKAIKLDLITSDLKREIQEVQAFTGNFVDLISGQRLTL
AEAKKEGLLTNEAVLSPGMMHGIVDPENCRIVPYSELVKKCKIDIESGQR
YLEVIPFSDIKDGVSDKVLTLSQAIQLGKVDFASTLKVLEAQANTGGIID
TATGKRLTLASALEEKLVDENMVRIIASHQVLNGGIVDIFSDQRVTLVEA
IEKRLISPELANMIQIDSSEFSDHRAQIEKQEGIEVCALQNEFLGKDMLI
ACNQTAEMSCNKVEESERLFQVENQSAQEKVKVRVSDGEQAKKSREISLK
EFGCKDQRKPRMSSDAKEFISIINPHNLKGKSLGQVSLTHPYSECDFKLK
EVARNNMGNDTNEEQEKAVTKIEIISHMKQSTSCLDSEEIRENQGEVILE
VQETYCETSGKLPSEQVLQQPMNARVKSKREKREVIVEESIRTCKPAFLS
EEKLYQETAIRDEHDSHIKSQPREMTSSEKGKEADTEMGFSITFKIEESS
SQVVPQGISVKHLDALTLFSSKQANEGKVNNLSLCLTLKPEENLSREIAC
GAQSEPFPCMTPRPEGLHYQESDGKAQVTGPSQISKTDKSFQGTTRQETN
YQDSWVTSKTKETKHQISSSNECKEKSYQEVSFDPARGLKLEEITVSRPD
SKEVRYLEFSDRKDLHHQGSKSDDKLCGTLKSEIATQELTGEKFLEMANP
NVAGLEAGSIEDIVTQRGSRVLGSFLPEKLFKGVSQKENTGQQNAIISPT
VLETSEEKTVSLTVCSAVKTEKTPQEKLRESPGSEQTPFMTAPEGKGNGG
VNPEPFRATQNVFTRQLCLEHDEKLVSYLSLLRNIEMRTKQIQPLELNLA
ELQDLLCQAKVLERELKDLTTLVSQELECVNQIIISQPQEVPAQLLKALE
KDAKNLQKSLSSVSDTWNSRLLHFQNAVEIEKTKVLNQHTQLEGRLQDLR
AWVGNKNLILNSKGSNSEIDVDSLNLCLQQYEDLKQPMAERKAQLDALAF
DIQFFISEHAQDLSPQQNRQMLRLLNELQRSFQDILEQTAAQVDALQGHL
QQMEQEALVKTLQKQQNTCHQQLEDLCSWVGQAERALAGHQGRTTQQDLS
ALQKNQSDLKDLQDDIQNRATSFATVVKDIEGFMEENQTKLSPRELTALR
EKLHQAKEQYEALQEETRVAQKELEEAVTSALQQETEKSKAAKELAENKK
KIDALLDWVTSVGSSGGQLLTNLPGMEQLSGASLEKGALDTTDGYMGVNQ
APEKLDKQCEMMKARHQELLSQQQNFILATQSAQAFLDQHGHNLTPEEQQ
MLQQKLGELKEQYSTSLAQSEAELKQVQTLQDELQKFLQDHKEFESWLER
SEKELENMHKGGSSPETLPSLLKRQGSFSEDVISHKGDLRFVTISGQKVL
DMENSFKEGKEPSEIGNLVKDKLKDATERYTALHSKCTRLGSHLNMLLGQ
YHQFQNSADSLQAWMQACEANVEKLLSDTVASDPGVLQEQLATTKQLQEE
LAEHQVPVEKLQKVARDIMEIEGEPAPDHRHVQETTDSILSHFQSLSYSL
AERSSLLQKAIAQSQSVQESLESLLQSIGEVEQNLEGKQVSSLSSGVIQE
ALATNMKLKQDIARQKSSLEATREMVTRFMETADSTTAAVLQGKLAEVSQ
RFEQLCLQQQEKESSLKKLLPQAEMFEHLSGKLQQFMENKSRMLASGNQP
DQDITHFFQQIQELNLEMEDQQENLDTLEHLVTELSSCGFALDLCQHQDR
VQNLRKDFTELQKTVKEREKDASSCQEQLDEFRKLVRTFQKWLKETEGSI
PPTETSMSAKELEKQIEHLKSLLDDWASKGTLVEEINCKGTSLENLIMEI
TAPDSQGKTGSILPSVGSSVGSVNGYHTCKDLTEIQCDMSDVNLKYEKLG
GVLHERQESLQAILNRMEEVHKEANSVLQWLESKEEVLKSMDAMSSPTKT
ETVKAQAESNKAFLAELEQNSPKIQKVKEALAGLLVTYPNSQEAENWKKI
QEELNSRWERATEVTVARQRQLEESASHLACFQAAESQLRPWLMEKELMM
GVLGPLSIDPNMLNAQKQQVQFMLKEFEARRQQHEQLNEAAQGILTGPGD
VSLSTSQVQKELQSINQKWVELTDKLNSRSSQIDQAIVKSTQYQELLQDL
SEKVRAVGQRLSVQSAISTQPEAVKQQLEETSEIRSDLEQLDHEVKEAQT
LCDELSVLIGEQYLKDELKKRLETVALPLQGLEDLAADRINRLQAALAST
QQFQQMFDELRTWLDDKQSQQAKNCPISAKLERLQSQLQENEEFQKSLNQ
HSGSYEVIVAEGESLLLSVPPGEEKRTLQNQLVELKNHWEELSKKTADRQ
SRLKDCMQKAQKYQWHVEDLVPWIEDCKAKMSELRVTLDPVQLESSLLRS
KAMLNEVEKRRSLLEILNSAADILINSSEADEDGIRDEKAGINQNMDAVT
EELQAKTGSLEEMTQRLREFQESFKNIEKKVEGAKHQLEIFDALGSQACS
NKNLEKLRAQQEVLQALEPQVDYLRNFTQGLVEDAPDGSDASQLLHQAEV
AQQEFLEVKQRVNSGCVMMENKLEGIGQFHCRVREMFSQLADLDDELDGM
GAIGRDTDSLQSQIEDVRLFLNKIHVLKLDIEASEAECRHMLEEEGTLDL
LGLKRELEALNKQCGKLTERGKARQEQLELTLGRVEDFYRKLKGLNDATT
AAEEAEALQWVVGTEVEIINQQLADFKMFQKEQVDPLQMKLQQVNGLGQG
LIQSAGKDCDVQGLEHDMEEINARWNTLNKKVAQRIAQLQEALLHCGKFQ
DALEPLLSWLADTEELIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKAT
VDMLQAEGGRIAQSAELADREKITGQLESLESRWTELLSKAAARQKQLED
ILVLAKQFHETAEPISDFLSVTEKKLANSEPVGTQTAKIQQQIIRHKALN
EEIVNRKKNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITVTS
SKALRTLEQARQLATKFQSTYEELTGWLREVEEELATSGGQSPTGEQIPQ
FQQRQKELKKEVMEHRLVLDTVNEVSRALLELVPWRAREGLDKLVSDANE
QYKLVSDTIGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPI
RLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRSEIFGTCGEEQKTVL
QEKTESLIQQYEAISLLNSERYARLERAQVLVNQFWETYEELSPWIEETR
ALIAQLPSPAIDHEQLRQQQEEMRQLRESIAEHKPHIDKLLKIGPQLKEL
NPEEGEMVEEKYQKAENMYAQIKEEVRQRALALDEAVSQSTQITEFHDKI
EPMLETLENLSSRLRMPPLIPAEVDKIRECISDNKSATVELEKLQPSFEA
LKRRGEELIGRSQGADKDLAAKEIQDKLDQMVFFWEDIKARAEEREIKFL
DVLELAEKFWYDMAALLTTIKDTQDIVHDLESPGIDPSIIKQQVEAAETI
KEETDGLHEELEFIRILGADLIFACGETEKPEVRKSIDEMNNAWENLNKT
WKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVK
DQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKATDETDRDIIREPLTEL
KHLWENLGEKIAHRQHKLEGALLALGQFQHALEELMSWLTHTEELLDAQR
PISGDPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDAS
SLRSRLEAMNQCWESVLQKTEEREQQLQSTLQQAQGFHSEIEDFLLELTR
MESQLSASKPTGGLPETAREQLDTHMELYSQLKAKEETYNQLLDKGRLML
LSRDDSGSGSKTEQSVALLEQKWHVVSSKMEERKSKLEEALNLATEFQNS
LQEFINWLTLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNAHRDQII
ELDQTGNQLKFLSQKQDVVLIKNLLVSVQSRWEKVVQRSIERGRSLDDAR
KRAKQFHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKT
LGGKQPVYDTTIRTGRALKEKTLLPEDSQKLDNFLGEVRDKWDTVCGKSV
ERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVMNL
MDAHKVFQKELGKRTGTVQVLKRSGRELIENSRDDTTWVKGQLQELSTRW
DTVCKLSVSKQSRLEQALKQAEVFRDTVHMLLEWLSEAEQTLRFRGALPD
DTEALQSLIDTHKEFMKKVEEKRVDVNSAVAMGEVILAVCHPDCITTIKH
WITIIRARFEEVLTWAKQHQQRLETALSELVANAELLEELLAWIQWAETT
LIQRDQEPIPQNIDRVKALIAEHQTFMEEMTRKQPDVDRVTKTYKRKNIE
PTHAPFIEKSRSGGRKSLSQPTPPPMPILSQSEAKNPRINQLSARWQQVW
LLALERQRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFF
RRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYY
EFVAALHPNKDAYRPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYR
FGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELRE
KFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPS
SPATPASGTKVIPSSGSKLKRPTPTFHSSRTSLAGDTSNSSSPASTGAKT
NRADPKKSASRPGSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTSES
SAAGGQGNSRRGLNKPSKIPTMSKKTTTASPRTPGPKR

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як сигнальний шлях Wnt, поліморфізм, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою актину, іонами металів, іоном кальцію. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних відростках, апараті гольджі.

Література[ред. | ред. код]

  • Gong T.-W.L., Besirli C.G., Lomax M.I. (2001). MACF1 gene structure: a hybrid of plectin and dystrophin.. Mamm. Genome 12: 852 — 861.  PubMed DOI:10.1007/s00335-001-3037-3
  • Kakinuma T., Ichikawa H., Tsukada Y., Nakamura T., Toh B.H. (2004). Interaction between p230 and MACF1 is associated with transport of a glycosyl phosphatidyl inositol-anchored protein from the Golgi to the cell periphery.. Exp. Cell Res. 298: 388 — 398.  PubMed DOI:10.1016/j.yexcr.2004.04.047
  • Lin C.-M., Chen H.-J., Leung C.L., Parry D.A.D., Liem R.K.H. (2005). Microtubule actin crosslinking factor 1b: a novel plakin that localizes to the Golgi complex.. J. Cell Sci. 118: 3727 — 3738.  PubMed DOI:10.1242/jcs.02510
  • Zaoui K., Benseddik K., Daou P., Salaun D., Badache A. (2010). ErbB2 receptor controls microtubule capture by recruiting ACF7 to the plasma membrane of migrating cells.. Proc. Natl. Acad. Sci. U.S.A. 107: 18517 — 18522.  PubMed DOI:10.1073/pnas.1000975107

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:13664 (англ.). Процитовано 28 серпня 2017. 
  3. UniProt, Q9UPN3 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]