DSTN (ген)

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DSTN
Destrin.png
Ідентифікатори
Символи DSTN, ACTDP, ADF, HEL32, bA462D18.2, destrin, actin depolymerizing factor
Зовнішні ІД OMIM: 609114 MGI: 1929270 HomoloGene: 21362 GeneCards: DSTN
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001011546
NM_006870
NM_019771
RefSeq (білок)
NP_001011546
NP_006861
NP_062745
Локус (UCSC) Хр. 20: 17.57 – 17.61 Mb Хр. 2: 143.92 – 143.94 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

DSTN (англ. Destrin, actin depolymerizing factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 165 амінокислот, а молекулярна маса — 18 506[4].

Послідовність амінокислот
1020304050
MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVE
EGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELM
FFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAE
KLGGSLIVAFEGCPV

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою актину.

Література[ред. | ред. код]

  • Hawkins M., Pope B., Maciver S.K., Weeds A.G. (1993). Human actin depolymerizing factor mediates a pH-sensitive destruction of actin filaments.. Biochemistry 32: 9985 — 9993.  PubMed DOI:10.1021/bi00089a014
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Yeoh S., Pope B., Mannherz H.G., Weeds A. (2002). Determining the differences in actin binding by human ADF and cofilin.. J. Mol. Biol. 315: 911 — 925.  PubMed DOI:10.1006/jmbi.2001.5280
  • Wong J.J., Pung Y.F., Sze N.S., Chin K.C. (2006). HERC5 is an IFN-induced HECT-type E3 protein ligase that mediates type I IFN-induced ISGylation of protein targets.. Proc. Natl. Acad. Sci. U.S.A. 103: 10735 — 10740.  PubMed DOI:10.1073/pnas.0600397103

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:15750 (англ.). Процитовано 21 вересня 2017. 
  4. UniProt, P60981 (англ.). Процитовано 21 вересня 2017. 

Див. також[ред. | ред. код]