ANK3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ANK3
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ANK3, ANKYRIN-G, MRT37, ankyrin 3, node of Ranvier (ankyrin G), ankyrin 3
Зовнішні ІД OMIM: 600465 MGI: 88026 HomoloGene: 56908 GeneCards: ANK3
Пов'язані генетичні захворювання
Біполярний афективний розлад, бічний аміотрофічний склероз, Значний депресивний розлад, шизофренія, unipolar depression[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001149
NM_001204403
NM_001204404
NM_020987
NM_001320874
RefSeq (білок)
NP_001140
NP_001191332
NP_001191333
NP_001307803
NP_066267
Локус (UCSC) Хр. 10: 60.03 – 60.73 Mb Хр. 10: 69.4 – 70.03 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ANK3 (англ. Ankyrin 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 4 377 амінокислот, а молекулярна маса — 480 410[5].

Послідовність амінокислот
1020304050
MAHAASQLKKNRDLEINAEEEPEKKRKHRKRSRDRKKKSDANASYLRAAR
AGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANV
DAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQE
NHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGK
VRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINV
ATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD
GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCV
QLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNG
FTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVS
QLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQ
TPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAF
LLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLT
PLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTL
LEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTP
LHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLL
QHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTAL
GIARRLGYISVVDTLKIVTEETMTTTTVTEKHKMNVPETMNEVLDMSDDE
VRKANAPEMLSDGEYISDVEEGEDAMTGDTDKYLGPQDLKELGDDSLPAE
GYMGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLT
FTREFDSDSLRHYSWAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGS
RHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMG
PAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDL
TELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIKQESNQIGPE
GGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFS
PIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITG
GTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQ
LYRELICVPYMAKFVVFAKMNDPVESSLRCFCMTDDKVDKTLEQQENFEE
VARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIK
IRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKETESDQDDE
IEKTDRRQSFASLALRKRYSYLTEPGMIERSTGATRSLPTTYSYKPFFST
RPYQSWTTAPITVPGPAKSGFTSLSSSSSNTPSASPLKSIWSVSTPSPIK
STLGASTTSSVKSISDVASPIRSFRTMSSPIKTVVSQSPYNIQVSSGTLA
RAPAVTEATPLKGLASNSTFSSRTSPVTTAGSLLERSSITMTPPASPKSN
INMYSSSLPFKSIITSAAPLISSPLKSVVSPVKSAVDVISSAKITMASSL
SSPVKQMPGHAEVALVNGSISPLKYPSSSTLINGCKATATLQEKISSATN
SVSSVVSAATDTVEKVFSTTTAMPFSPLRSYVSAAPSAFQSLRTPSASAL
YTSLGSSISATTSSVTSSIITVPVYSVVNVLPEPALKKLPDSNSFTKSAA
ALLSPIKTLTTETHPQPHFSRTSSPVKSSLFLAPSALKLSTPSSLSSSQE
ILKDVAEMKEDLMRMTAILQTDVPEEKPFQPELPKEGRIDDEEPFKIVEK
VKEDLVKVSEILKKDVCVDNKGSPKSPKSDKGHSPEDDWIEFSSEEIREA
RQQAAASQSPSLPERVQVKAKAASEKDYNLTKVIDYLTNDIGSSSLTNLK
YKFEDAKKDGEERQKRVLKPAIALQEHKLKMPPASMRTSTSEKELCKMAD
SFFGTDTILESPDDFSQHDQDKSPLSDSGFETRSEKTPSAPQSAESTGPK
PLFHEVPIPPVITETRTEVVHVIRSYDPSAGDVPQTQPEEPVSPKPSPTF
MELEPKPTTSSIKEKVKAFQMKASSEEDDHNRVLSKGMRVKEETHITTTT
RMVYHSPPGGEGASERIEETMSVHDIMKAFQSGRDPSKELAGLFEHKSAV
SPDVHKSAAETSAQHAEKDNQMKPKLERIIEVHIEKGNQAEPTEVIIRET
KKHPEKEMYVYQKDLSRGDINLKDFLPEKHDAFPCSEEQGQQEEEELTAE
ESLPSYLESSRVNTPVSQEEDSRPSSAQLISDDSYKTLKLLSQHSIEYHD
DELSELRGESYRFAEKMLLSEKLDVSHSDTEESVTDHAGPPSSELQGSDK
RSREKIATAPKKEILSKIYKDVSENGVGKVSKDEHFDKVTVLHYSGNVSS
PKHAMWMRFTEDRLDRGREKLIYEDRVDRTVKEAEEKLTEVSQFFRDKTE
KLNDELQSPEKKARPKNGKEYSSQSPTSSSPEKVLLTELLASNDEWVKAR
QHGPDGQGFPKAEEKAPSLPSSPEKMVLSQQTEDSKSTVEAKGSISQSKA
PDGPQSGFQLKQSKLSSIRLKFEQGTHAKSKDMSQEDRKSDGQSRIPVKK
IQESKLPVYQVFAREKQQKAIDLPDESVSVQKDFMVLKTKDEHAQSNEIV
VNDSGSDNVKKQRTEMSSKAMPDSFSEQQAKDLACHITSDLATRGPWDKK
VFRTWESSGATNNKSQKEKLSHVLVHDVRENHIGHPESKSVDQKNEFMSV
TERERKLLTNGSLSEIKEMTVKSPSKKVLYREYVVKEGDHPGGLLDQPSR
RSESSAVSHIPVRVADERRMLSSNIPDGFCEQSAFPKHELSQKLSQSSMS
KETVETQHFNSIEDEKVTYSEISKVSKHQSYVGLCPPLEETETSPTKSPD
SLEFSPGKESPSSDVFDHSPIDGLEKLAPLAQTEGGKEIKTLPVYVSFVQ
VGKQYEKEIQQGGVKKIISQECKTVQETRGTFYTTRQQKQPPSPQGSPED
DTLEQVSFLDSSGKSPLTPETPSSEEVSYEFTSKTPDSLIAYIPGKPSPI
PEVSEESEEEEQAKSTSLKQTTVEETAVEREMPNDVSKDSNQRPKNNRVA
YIEFPPPPPLDADQIESDKKHHYLPEKEVDMIEVNLQDEHDKYQLAEPVI
RVQPPSPVPPGADVSDSSDDESIYQPVPVKKYTFKLKEVDDEQKEKPKAS
AEKASNQKELESNGSGKDNEFGLGLDSPQNEIAQNGNNDQSITECSIATT
AEFSHDTDATEIDSLDGYDLQDEDDGLTESDSKLPIQAMEIKKDIWNTEG
ILKPADRSFSQSKLEVIEEEGKVGPDEDKPPSKSSSSEKTPDKTDQKSGA
QFFTLEGRHPDRSVFPDTYFSYKVDEEFATPFKTVATKGLDFDPWSNNRG
DDEVFDSKSREDETKPFGLAVEDRSPATTPDTTPARTPTDESTPTSEPNP
FPFHEGKMFEMTRSGAIDMSKRDFVEERLQFFQIGEHTSEGKSGDQGEGD
KSMVTATPQPQSGDTTVETNLERNVETPTVEPNPSIPTSGECQEGTSSSG
SLEKSAAATNTSKVDPKLRTPIKMGISASTMTMKKEGPGEITDKIEAVMT
SCQGLENETITMISNTANSQMGVRPHEKHDFQKDNFNNNNNLDSSTIQTD
NIMSNIVLTEHSAPTCTTEKDNPVKVSSGKKTGVLQGHCVRDKQKVLGEQ
QKTKELIGIRQKSKLPIKATSPKDTFPPNHMSNTKASKMKQVSQSEKTKA
LTTSSCVDVKSRIPVKNTHRDNIIAVRKACATQKQGQPEKGKAKQLPSKL
PVKVRSTCVTTTTTTATTTTTTTTTTTTSCTVKVRKSQLKEVCKHSIEYF
KGISGETLKLVDRLSEEEKKMQSELSDEEESTSRNTSLSETSRGGQPSVT
TKSARDKKTEAAPLKSKSEKAGSEKRSSRRTGPQSPCERTDIRMAIVADH
LGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNAT
TDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDGW
QNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSYLKGEAGKFEA
NGSHTEITPEAKTKSYFPESQNDVGKQSTKETLKPKIHGSGHVEEPASPL
AAYQKSLEETSKLIIEETKPCVPVSMKKMSRTSPADGKPRLSLHEEEGSS
GSEQKQGEGFKVKTKKEIRHVEKKSHS

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних контактах, клітинних відростках, лізосомі, апараті гольджі, синапсах.

Література[ред. | ред. код]

  • Kordeli E., Lambert S., Bennett V. (1995). AnkyrinG. A new ankyrin gene with neural-specific isoforms localized at the axonal initial segment and node of Ranvier.. J. Biol. Chem. 270: 2352 — 2359.  PubMed DOI:10.1074/jbc.270.5.2352
  • Maiweilidan Y., Klauza I., Kordeli E. (2011). Novel interactions of ankyrins-G at the costameres: the muscle-specific Obscurin/Titin-Binding-related Domain (OTBD) binds plectin and filamin C.. Exp. Cell Res. 317: 724 — 736.  PubMed DOI:10.1016/j.yexcr.2011.01.002
  • Liu Y., Zhang Y., Wang J.H. (2014). Crystal structure of human Ankyrin G death domain.. Proteins 82: 3476 — 3482.  PubMed DOI:10.1002/prot.24702

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]