ANK1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ANK1
Protein ANK1 PDB 1n11.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ANK1, ANK, SPH1, SPH2, ankyrin 1
Зовнішні ІД OMIM: 612641 MGI: 88024 HomoloGene: 55427 GeneCards: ANK1
Пов'язані генетичні захворювання
hereditary spherocytosis type 1[1]
Шаблон експресії
PBB GE ANK1 205389 s at fs.png

PBB GE ANK1 205391 x at fs.png

PBB GE ANK1 205390 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 8: 41.65 – 41.9 Mb Хр. 8: 22.97 – 23.15 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ANK1 (англ. Ankyrin 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 881 амінокислот, а молекулярна маса — 206 265[5].

Послідовність амінокислот
1020304050
MPYSVGFREADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLH
LASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNY
GANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAV
ALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPD
VLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRG
NVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQA
KTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGH
HRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAV
TESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHT
EVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLAT
TAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVR
VAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAW
NGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEM
VALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRM
GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIV
TLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSD
KHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKL
DQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSD
NISPVASPVHTGFLVSFMVDARGGSMRGSRHNGLRVVIPPRTCAAPTRIT
CRLVKPQKLSTPPPLAEEEGLASRIIALGPTGAQFLSPVIVEIPHFASHG
RGDRELVVLRSENGSVWKEHRSRYGESYLDQILNGMDEELGSLEELEKKR
VCRIITTDFPLYFVIMSRLCQDYDTIGPEGGSLKSKLVPLVQATFPENAV
TKRVKLALQAQPVPDELVTKLLGNQATFSPIVTVEPRRRKFHRPIGLRIP
LPPSWTDNPRDSGEGDTTSLRLLCSVIGGTDQAQWEDITGTTKLVYANEC
ANFTTNVSARFWLSDCPRTAEAVNFATLLYKELTAVPYMAKFVIFAKMND
PREGRLRCYCMTDDKVDKTLEQHENFVEVARSRDIEVLEGMSLFAELSGN
LVPVKKAAQQRSFHFQSFRENRLAMPVKVRDSSREPGGSLSFLRKAMKYE
DTQHILCHLNITMPPCAKGSGAEDRRRTPTPLALRYSILSESTPGSLSGT
EQAEMKMAVISEHLGLSWAELARELQFSVEDINRIRVENPNSLLEQSVAL
LNLWVIREGQNANMENLYTALQSIDRGEIVNMLEGSGRQSRNLKPDRRHT
DRDYSLSPSQMNGYSSLQDELLSPASLGCALSSPLRADQYWNEVAVLDAI
PLAATEHDTMLEMSDMQVWSAGLTPSLVTAEDSSLECSKAEDSDATGHEW
KLEGALSEEPRGPELGSLELVEDDTVDSDATNGLIDLLEQEEGQRSEEKL
PGSKRQDDATGAGQDSENEVSLVSGHQRGQARITHSPTVSQVTERSQDRL
QDWDADGSIVSYLQDAAQGSWQEEVTQGPHSFQGTSTMTEGLEPGGSQEY
EKVLVSVSEHTWTEQPEAESSQADRDRRQQGQEEQVQEAKNTFTQVVQGN
EFQNIPGEQVTEEQFTDEQGNIVTKKIIRKVVRQIDLSSADAAQEHEEVT
VEGPLEDPSELEVDIDYFMKHSKDHTSTPNP

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у цитоплазмі, цитоскелеті, мембрані, саркоплазматичному ретикулумі.

Література[ред. | ред. код]

  • Lux S.E., John K.M., Bennett V. (1990). Analysis of cDNA for human erythrocyte ankyrin indicates a repeated structure with homology to tissue-differentiation and cell-cycle control proteins.. Nature 344: 36 — 42.  PubMed DOI:10.1038/344036a0
  • Gallagher P.G., Tse W.T., Scarpa A.L., Lux S.E., Forget B.G. (1997). Structure and organization of the human ankyrin-1 gene. Basis for complexity of pre-mRNA processing.. J. Biol. Chem. 272: 19220 — 19228.  PubMed DOI:10.1074/jbc.272.31.19220
  • Gallagher P.G., Forget B.G. (1998). An alternate promoter directs expression of a truncated, muscle-specific isoform of the human ankyrin 1 gene.. J. Biol. Chem. 273: 1339 — 1348.  PubMed DOI:10.1074/jbc.273.3.1339
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Michaely P., Bennett V. (1995). The ANK repeats of erythrocyte ankyrin form two distinct but cooperative binding sites for the erythrocyte anion exchanger.. J. Biol. Chem. 270: 22050 — 22057.  PubMed DOI:10.1074/jbc.270.37.22050
  • Kontrogianni-Konstantopoulos A., Bloch R.J. (2003). The hydrophilic domain of small ankyrin-1 interacts with the two N-terminal immunoglobulin domains of titin.. J. Biol. Chem. 278: 3985 — 3991.  PubMed DOI:10.1074/jbc.M209012200

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]