Важкий ланцюг міозину, ізоформа 9

Матеріал з Вікіпедії — вільної енциклопедії.
(Перенаправлено з MYH9)
Перейти до навігації Перейти до пошуку
Важкий ланцюг міозину, ізоформа 9
Ідентифікатори
Символи NMMHC-IIAnon-muscle myosin heavy chain AMYH9non-muscle myosin heavy polypeptide 9myosin-9non-muscle myosin heavy chain 9NMMHC-Anon-muscle myosin heavy chain IIacellular myosin heavy chaintype Anonmuscle myosin heavy chain II-AMyosin heavy chainnon-muscle IIaNMMHC II-amyosinheavy chain 9non-muscle
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

Важкий ланцюг міозину, ізоформа 9 (англ. Myosin heavy chain 9) – білок, який кодується геном MYH9, розташованим у людей на короткому плечі 22-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 1 960 амінокислот, а молекулярна маса — 226 532[2].

Послідовність амінокислот
1020304050
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEV
GEEAIVELVENGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHN
LKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVEMYKGKKRHEMPPHI
YAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVASSHKS
KKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIV
GANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLG
NIVFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDY
VQKAQTKEQADFAIEALAKATYERMFRWLVLRINKALDKTKRQGASFIGI
LDIAGFEIFDLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWN
FIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKSFVEKVMQEQ
GTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLY
KEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEG
IRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELD
SNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFA
KRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQVSRQEEEMMAK
EEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEE
QLEEEESARQKLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDR
IAEFTTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTR
RKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKN
MALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEELEALKTELED
TLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKV
EAQLQELQVKFNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLT
KDFSALESQLQDTQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEE
AKHNLEKQIATLHAQVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQR
HEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQLL
AEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK
QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQA
TEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELED
ERKQRSMAVAARKKLEMDLKDLEAHIDSANKNRDEAIKQLRKLQAQMKDC
MRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQ
QERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELIND
RLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGT
VKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQ
VDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQREL
EDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGK
ADGAEAKPAE

Цей білок за функціями належить до білкових моторів, міозинів. Задіяний у таких біологічних процесах як клітинна адгезія, пдтримання форми клітини. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою актину, молекулою кальмодуліну. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Kato S., Ohtoko K., Ohtake H., Kimura T. (2005). Vector-capping: a simple method for preparing a high-quality full-length cDNA library.. DNA Res. 12: 53 — 62.  PubMed DOI:10.1093/dnares/12.1.53
  • Saez C.G., Myers J.C., Shows T.B., Leinwand L.A. (1990). Human nonmuscle myosin heavy chain mRNA: generation of diversity through alternative polyadenylylation.. Proc. Natl. Acad. Sci. U.S.A. 87: 1164 — 1168.  PubMed DOI:10.1073/pnas.87.3.1164
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Giorgianni F., Zhao Y., Desiderio D.M., Beranova-Giorgianni S. (2007). Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.. Electrophoresis 28: 2027 — 2034.  PubMed DOI:10.1002/elps.200600782
  • Takizawa N., Ikebe R., Ikebe M., Luna E.J. (2007). Supervillin slows cell spreading by facilitating myosin II activation at the cell periphery.. J. Cell Sci. 120: 3792 — 3803.  PubMed DOI:10.1242/jcs.008219
  • Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J. (2008). Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.. J. Proteome Res. 7: 5167 — 5176.  PubMed DOI:10.1021/pr800500r

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:7579 (англ.). Процитовано 30 січня 2017. 
  2. UniProt, P35579 (англ.). Процитовано 30 січня 2017. 

Див. також[ред. | ред. код]