Легкий ланцюг міозину 6

Матеріал з Вікіпедії — вільної енциклопедії.
(Перенаправлено з MYL6)
Перейти до навігації Перейти до пошуку
Легкий ланцюг міозину 6
Ідентифікатори
Символи MYL6, ESMLC, LC17, LC17-GI, LC17-NM, LC17A, LC17B, MLC-3, MLC1SM, MLC3NM, MLC3SM, myosin light chain 6
Зовнішні ІД OMIM: 609931 MGI: 109318 HomoloGene: 69080 GeneCards: MYL6
Шаблон експресії
PBB GE MYL6 212082 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_079425
NM_021019
NM_079423
NM_010860
NM_001317217
NM_001317218
NM_001317219
NM_001317220
RefSeq (білок)
NP_066299
NP_524147
NP_001304146
NP_001304147
NP_001304148
NP_001304149
NP_034990
Локус (UCSC) Хр. 12: 56.16 – 56.16 Mb Хр. 10: 128.49 – 128.49 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Легкий ланцюг міозину 6 (англ. Myosin light chain 6) – білок, який кодується геном MYL6, розташованим у людей на короткому плечі 12-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 151 амінокислот, а молекулярна маса — 16 930[4].

Послідовність амінокислот
1020304050
MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLK
VLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEG
NGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILS
G

Цей білок за функціями належить до білкових моторів, міозинів, м'язових білків.

Література[ред. | ред. код]

  • Hailstones D.L., Gunning P.W. (1990). Characterization of human myosin light chains 1sa and 3nm: implications for isoform evolution and function.. Mol. Cell. Biol. 10: 1095 — 1104.  PubMed DOI:10.1128/MCB.10.3.1095
  • Bora P.S., Bora N.S., Wu X., Kaplan H.J., Lange L.G. (1994). Molecular cloning, sequencing, and characterization of smooth muscle myosin alkali light chain from human eye cDNA: homology with myocardial fatty acid ethyl ester synthase-III cDNA.. Genomics 19: 186 — 188.  PubMed DOI:10.1006/geno.1994.1041
  • Watanabe M., Kohri M., Takaishi M., Horie R., Higashihara M. (2001). Molecular cloning and sequencing of myosin light chains in human megakaryoblastic leukemia cells.. J. Smooth Muscle Res. 37: 25 — 38.  PubMed DOI:10.1540/jsmr.37.25
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lenz S., Lohse P., Seidel U., Arnold H.H. (1989). The alkali light chains of human smooth and nonmuscle myosins are encoded by a single gene. Tissue-specific expression by alternative splicing pathways.. J. Biol. Chem. 264: 9009 — 9015.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7587 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, P60660 (англ.). Процитовано 30 січня 2017. 

Див. також[ред. | ред. код]