MYH11

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYH11
Protein MYH11 PDB 1br1.png
Ідентифікатори
Символи MYH11, AAT4, FAA4, SMHC, SMMHC, myosin, heavy chain 11, smooth muscle, myosin heavy chain 11
Зовнішні ІД OMIM: 160745 MGI: 102643 HomoloGene: 128512 GeneCards: MYH11
Шаблон експресії
PBB GE MYH11 201496 x at fs.png

PBB GE MYH11 201497 x at fs.png

PBB GE MYH11 201495 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001040113
NM_001040114
NM_002474
NM_022844
NM_001161775
NM_013607
RefSeq (білок)
NP_001155247
NP_038635
Локус (UCSC) Хр. 16: 15.7 – 15.86 Mb Хр. 16: 14.19 – 14.29 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYH11 (англ. Myosin heavy chain 11) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 972 амінокислот, а молекулярна маса — 227 339[4].

Послідовність амінокислот
1020304050
MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASI
KEEKGDEVVVELVENGKKVTVGKDDIQKMNPPKFSKVEDMAELTCLNEAS
VLHNLRERYFSGLIYTYSGLFCVVVNPYKHLPIYSEKIVDMYKGKKRHEM
PPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVAS
SHKGKKDTSITGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINF
DVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYMIAGAKEKMRSDLL
LEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVV
SSVLQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPR
IKVGRDVVQKAQTKEQADFAVEALAKATYERLFRWILTRVNKALDKTHRQ
GASFLGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQ
REGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECWFPKATDKSFV
EKLCTEQGSHPKFQKPKQLKDKTEFSIIHYAGKVDYNASAWLTKNMDPLN
DNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMF
RTVGQLYKEQLGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLR
CNGVLEGIRICRQGFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILM
IKALELDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDVIMAFQAMCRGY
LARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQ
EEEMQAKEDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAET
ELYAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQ
QMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDEILVMDDQNNKLSKE
RKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSR
QELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQAALARLD
DEIAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEA
LKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQK
HAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEV
EHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAE
GKAIKLAKDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEEERNSLQD
QLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRFQKE
IENLTQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQ
RKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEAKE
ELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEE
LEDELQATEDAKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQLHE
YETELEDERKQRALAAAAKKKLEGDLKDLELQADSAIKGREEAIKQLRKL
QAQMKDFQRELEDARASRDEIFATAKENEKKAKSLEADLMQLQEDLAAAE
RARKQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQG
NMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSK
LHEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKK
LKEILLQVEDERKMAEQYKEQAEKGNARVKQLKRQLEEAEEESQRINANR
RKLQRELDEATESNEAMGREVNALKSKLRRGNETSFVPSRRSGGRRVIEN
ADGSEEETDTRDADFNGTKASE

Кодований геном білок за функціями належить до білкових моторів, міозинів, м'язових білків, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою актину, молекулою кальмодуліну.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7569 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P35749 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]