KRT86

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KRT86
Ідентифікатори
Символи KRT86, HB6, Hb1, KRTHB1, KRTHB6, MNX, hHb6, K86, keratin 86
Зовнішні ІД OMIM: 601928 MGI: 109362 HomoloGene: 1717 GeneCards: KRT86
Пов'язані генетичні захворювання
monilethrix[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002284
NM_001320198
NM_010667
RefSeq (білок)
NP_001307127
NP_034797
Локус (UCSC) Хр. 12: 52.25 – 52.31 Mb Хр. 15: 101.47 – 101.48 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KRT86 (англ. Keratin 86) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 486 амінокислот, а молекулярна маса — 53 501[5].

Послідовність амінокислот
1020304050
MTCGSYCGGRAFSCISACGPRPGRCCITAAPYRGISCYRGLTGGFGSHSV
CGGFRAGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQ
CVKQEEKEQIKSLNSRFAAFIDKVRFLEQQNKLLETKLQFYQNRECCQSN
LEPLFEGYIETLRREAECVEADSGRLASELNHVQEVLEGYKKKYEEEVSL
RATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLRRLYEEEIRVL
QSHISDTSVVVKLDNSRDLNMDCIIAEIKAQYDDIVTRSRAEAESWYRSK
CEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAV
AQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLD
IEIATYRRLLEGEEQRLCEGVGSVNVCVSSSRGGVVCGDLCASTTAPVVS
TRVSSVPSNSNVVVGTTNACAPSARVGVCGGSCKRC

Локалізований у проміжних філаментах.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Winter H., Clark R.D., Tarras-Wahlberg C., Rogers M.A., Schweizer J. (1999). Monilethrix: a novel mutation (Glu402Lys) in the helix termination motif and the first causative mutation (Asn114Asp) in the helix initiation motif of the type II hair keratin hHb6.. J. Invest. Dermatol. 113: 263 — 266.  PubMed DOI:10.1046/j.1523-1747.1999.00685.x
  • Pearce E.G., Smith S.K., Lanigan S.W., Bowden P.E. (1999). Two different mutations in the same codon of a type II hair keratin (hHb6) in patients with monilethrix.. J. Invest. Dermatol. 113: 1123 — 1127.  PubMed DOI:10.1046/j.1523-1747.1999.00777.x

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]