KRT3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KRT3
Ідентифікатори
Символи KRT3, CK3, K3, keratin 3
Зовнішні ІД OMIM: 148043 GeneCards: KRT3
Пов'язані генетичні захворювання
Meesmann corneal dystrophy[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_057088
н/д
RefSeq (білок)
NP_476429
н/д
Локус (UCSC) Хр. 12: 52.79 – 52.8 Mb н/д
PubMed search [2] н/д
Вікідані
Див./Ред. для людей

KRT3 (англ. Keratin 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 628 амінокислот, а молекулярна маса — 64 417[4].

Послідовність амінокислот
1020304050
MSRQASKTSGGGSQGFSGRSAVVSGSSRMSCVAHSGGAGGGAYGFRSGAG
GFGSRSLYNLGGNKSISISVAAGGSRAGGFGGGRSSCAFAGGYGGGFGSG
YGGGFGGGFGGGRGMGGGFGGAGGFGGAGGFGGAGGFGGPGGFGGSGGFG
GPGSLGSPGGFGPGGFPGGIQEVTINQSLLQPLNVEIDPQIGQVKAQERE
QIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQQGTSSISGTNNLEPL
FENHINYLRSYLDNILGERGRLDSELKNMEDLVEDFKKKYEDEINKRTAA
ENEFVTLKKDVDSAYMNKVELQAKVDALIDEIDFLRTLYDAELSQMQSHI
SDTSVVLSMDNNRSLDLDSIIAEVRAQYEDIAQRSKAEAEALYQTKLGEL
QTTAGRHGDDLRNTKSEIIELNRMIQRLRAEIEGVKKQNANLQTAIAEAE
QHGEMALKDANAKLQELQAALQQAKDDLARLLRDYQELMNVKLALDVEIA
TYRKLLEGEEYRMSGECPSAVSISVVSSSTTSASAGGYGGGYGGGMGGGL
GGGFSAGGGSGSGFGRGGGGGIGGGFGGGSSGFSGGSGFGSISGARYGVS
GGGFSSASNRGGSIKFSQSSQSSQRYSR

Кодований геном білок за функцією належить до фосфопротеїнів. Локалізований у проміжних філаментах.

Література[ред. | ред. код]

  • Klinge E.M., Sylvestre Y.R., Freedberg I.M., Blumenberg M. (1987). Evolution of keratin genes: different protein domains evolve by different pathways.. J. Mol. Evol. 24: 319 — 329.  PubMed DOI:10.1007/BF02134130
  • Chen Y.T., Tseng S.H., Chao S.C. (2005). Novel mutations in the helix termination motif of keratin 3 and keratin 12 in 2 Taiwanese families with Meesmann corneal dystrophy.. Cornea 24: 928 — 932.  PubMed DOI:10.1097/01.ico.0000159732.29930.26

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]