TNNI1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TNNI1
Ідентифікатори
Символи TNNI1, SSTNI, TNN1, troponin I1, slow skeletal type
Зовнішні ІД OMIM: 191042 MGI: 105073 HomoloGene: 2462 GeneCards: TNNI1
Шаблон експресії
PBB GE TNNI1 205177 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003281
NM_001112702
NM_021467
RefSeq (білок)
NP_003272
NP_001106173
NP_067442
Локус (UCSC) Хр. 1: 201.4 – 201.43 Mb Хр. 1: 135.78 – 135.81 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TNNI1 (англ. Troponin I1, slow skeletal type) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 187 амінокислот, а молекулярна маса — 21 692[4].

Послідовність амінокислот
1020304050
MPEVERKPKITASRKLLLKSLMLAKAKECWEQEHEEREAEKVRYLAERIP
TLQTRGLSLSALQDLCRELHAKVEVVDEERYDIEAKCLHNTREIKDLKLK
VMDLRGKFKRPPLRRVRVSADAMLRALLGSKHKVSMDLRANLKSVKKEDT
EKERPVEVGDWRKNVEAMSGMEGRKKMFDAAKSPTSQ

Кодований геном білок за функціями належить до м'язових білків, фосфопротеїнів. Задіяний у таких біологічних процесах як поліморфізм, ацетиляція. Білок має сайт для зв'язування з молекулою актину, іонами металів, іоном кальцію.

Література[ред. | ред. код]

  • Wade R., Eddy R., Shows T.B., Kedes L. (1990). cDNA sequence, tissue-specific expression, and chromosomal mapping of the human slow-twitch skeletal muscle isoform of troponin I.. Genomics 7: 346 — 357.  PubMed DOI:10.1016/0888-7543(90)90168-T
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11945 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, P19237 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]