MYH2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYH2
Ідентифікатори
Символи MYH2, IBM3, MYH2A, MYHSA2, MYHas8, MyHC-2A, MyHC-IIa, MYPOP, myosin, heavy chain 2, skeletal muscle, adult, myosin heavy chain 2
Зовнішні ІД OMIM: 160740 MGI: 1339710 HomoloGene: 23019 GeneCards: MYH2
Шаблон експресії
PBB GE MYH2 204631 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_017534
NM_001100112
NM_001039545
NM_144961
RefSeq (білок)
NP_001093582
NP_060004
NP_001034634
Локус (UCSC) Хр. 17: 10.52 – 10.55 Mb Хр. 11: 67.17 – 67.2 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYH2 (англ. Myosin heavy chain 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 941 амінокислот, а молекулярна маса — 223 044[4].

Послідовність амінокислот
1020304050
MSSDSELAVFGEAAPFLRKSERERIEAQNRPFDAKTSVFVAEPKESFVKG
TIQSREGGKVTVKTEGGATLTVKDDQVFPMNPPKYDKIEDMAMMTHLHEP
AVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYKPEVVTAYRGKKRQE
APPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIA
VTGEKKKEEITSGKIQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKF
IRIHFGTTGKLASADIETYLLEKSRVVFQLKAERSYHIFYQITSNKKPEL
IEMLLITTNPYDYPFVSQGEISVASIDDQEELMATDSAIDILGFTNEEKV
SIYKLTGAVMHYGNLKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLK
ALCYPRVKVGNEYVTKGQTVEQVSNAVGALAKAVYEKMFLWMVARINQQL
DTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLE
QEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTS
FKNKLYDQHLGKSANFQKPKVVKGKAEAHFALIHYAGVVDYNITGWLEKN
KDPLNETVVGLYQKSAMKTLAQLFSGAQTAEGEGAGGGAKKGGKKKGSSF
QTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLR
CNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEK
LLASIDIDHTQYKFGHTKVFFKAGLLGLLEEMRDDKLAQLITRTQARCRG
FLARVEYQRMVERREAIFCIQYNIRSFMNVKHWPWMKLFFKIKPLLKSAE
TEKEMATMKEEFQKIKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQAE
AEGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLE
DECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTK
EKKALQEAHQQTLDDLQAEEDKVNTLTKAKIKLEQQVDDLEGSLEQEKKL
RMDLERAKRKLEGDLKLAQESIMDIENEKQQLDEKLKKKEFEISNLQSKI
EDEQALGIQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELE
EISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRK
KHADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNVETVSKAKGN
LEKMCRTLEDQLSELKSKEEEQQRLINDLTAQRGRLQTESGEFSRQLDEK
EALVSQLSRGKQAFTQQIEELKRQLEEEIKAKNALAHALQSSRHDCDLLR
EQYEEEQESKAELQRALSKANTEVAQWRTKYETDAIQRTEELEEAKKKLA
QRLQAAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERTNAACAALDK
KQRNFDKILAEWKQKCEETHAELEASQKEARSLGTELFKIKNAYEESLDQ
LETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKCELQAAL
EEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHIRIV
ESMQSTLDAEIRSRNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYR
NTQGILKDTQIHLDDALRSQEDLKEQLAMVERRANLLQAEIEELRATLEQ
TERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDISQMQGEMEDI
LQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQ
LRLDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNAEAVKGLRKHE
RRVKELTYQTEEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNTNLA
KFRKLQHELEEAEERADIAESQVNKLRVKSREVHTKVISEE

Кодований геном білок за функціями належить до білкових моторів, міозинів, м'язових білків. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою актину, молекулою кальмодуліну. Локалізований у цитоплазмі.

Література[ред. | ред. код]

  • Weiss A., Schiaffino S., Leinwand L.A. (1999). Comparative sequence analysis of the complete human sarcomeric myosin heavy chain family: implications for functional diversity.. J. Mol. Biol. 290: 61 — 75.  PubMed DOI:10.1006/jmbi.1999.2865
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Ennion S., Sant'ana Pereira J., Sargeant T., Young A., Goldspink G. (1995). Characterization of human skeletal muscle fibres according to the myosin heavy chains they express.. J. Muscle Res. Cell Motil. 16: 35 — 43.  PubMed DOI:10.1007/BF00125308
  • Smerdu V., Karsch-Mizrachi I., Campione M., Leinwand L., Schiaffino S. (1994). Type IIx myosin heavy chain transcripts are expressed in type IIb fibers of human skeletal muscle.. Am. J. Physiol. 267: C1723 — C1728.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7572 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9UKX2 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]