Кератин-17

Матеріал з Вікіпедії — вільної енциклопедії.
(Перенаправлено з KRT17)
Перейти до навігації Перейти до пошуку
KRT17
Ідентифікатори
Символи KRT17, K17, PC, PC2, PCHC1, 39.1, CK-17, keratin 17
Зовнішні ІД OMIM: 148069 MGI: 96691 HomoloGene: 363 GeneCards: KRT17
Шаблон експресії
PBB GE KRT17 205157 s at fs.png

PBB GE KRT17 212236 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000422
NM_010663
RefSeq (білок)
NP_000413
NP_034793
Локус (UCSC) Хр. 17: 41.62 – 41.62 Mb Хр. 11: 100.26 – 100.26 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KRT17 (англ. Keratin 17) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 432 амінокислот, а молекулярна маса — 48 106[4].

Послідовність амінокислот
1020304050
MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGS
TLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLD
KVRALEEANTELEVKIRDWYQRQAPGPARDYSQYYRTIEELQNKILTATV
DNANILLQIDNARLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLA
RADLEMQIENLKEELAYLKKNHEEEMNALRGQVGGEINVEMDAAPGVDLS
RILNEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEI
SELRRTMQALEIELQSQLSMKASLEGNLAETENRYCVQLSQIQGLIGSVE
EQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKK
EPVTTRQVRTIVEEVQDGKVISSREQVHQTTR

Кодований геном білок за функцією належить до фосфопротеїнів. Локалізований у цитоплазмі, проміжних філаментах.

Література[ред. | ред. код]

  • Flohr T., Buwitt U., Bonnekoh B., Decker T., Boettger E.C. (1992). Interferon-gamma regulates expression of a novel keratin class I gene.. Eur. J. Immunol. 22: 975 — 979.  PubMed DOI:10.1002/eji.1830220415
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • McGowan K.M., Coulombe P.A. (2000). Keratin 17 expression in the hard epithelial context of the hair and nail, and its relevance for the pachyonychia congenita phenotype.. J. Invest. Dermatol. 114: 1101 — 1107.  PubMed DOI:10.1046/j.1523-1747.2000.00986.x
  • Shen Z., Wang G., Fan J.-Y., Li W., Liu Y.-F. (2005). HLA DR B1*04, *07-restricted epitopes on Keratin 17 for autoreactive T cells in psoriasis.. J. Dermatol. Sci. 38: 25 — 39.  PubMed DOI:10.1016/j.jdermsci.2005.01.001
  • Bockelmann R., Horn T., Gollnick H., Bonnekoh B. (2005). Interferon-gamma-dependent in vitro model for the putative keratin 17 autoimmune loop in psoriasis: exploration of pharmaco- and gene-therapeutic effects.. Skin Pharmacol. Physiol. 18: 42 — 54.  PubMed DOI:10.1159/000081685
  • Pan X., Kane L.A., Van Eyk J.E., Coulombe P.A. (2011). Type I keratin 17 protein is phosphorylated on serine 44 by p90 ribosomal protein S6 kinase 1 (RSK1) in a growth- and stress-dependent fashion.. J. Biol. Chem. 286: 42403 — 42413.  PubMed DOI:10.1074/jbc.M111.302042

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6427 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q04695 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]