Альфа-тубулін 8

Матеріал з Вікіпедії — вільної енциклопедії.
(Перенаправлено з TUBA8)
Перейти до навігації Перейти до пошуку
Альфа-тубулін 8
Protein TUBA8 PDB 1tub.png
Ідентифікатори
Символи TUBA8, TUBAL2, tubulin alpha 8, CDCBM8
Зовнішні ІД OMIM: 605742 MGI: 1858225 HomoloGene: 56766 GeneCards: TUBA8
Пов'язані генетичні захворювання
polymicrogyria with optic nerve hypoplasia[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_018943
NM_001193414
NM_017379
RefSeq (білок)
NP_001180343
NP_061816
NP_059075
Локус (UCSC) Хр. 22: 18.11 – 18.15 Mb Хр. 6: 121.21 – 121.23 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Альфа-тубулін 8 (англ. Tubulin alpha 8) – білок, який кодується геном TUBA8, розташованим у людей на короткому плечі 22-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 449 амінокислот, а молекулярна маса — 50 094[5].

Послідовність амінокислот
1020304050
MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQASKINDDDSFT
TFFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAA
NNYARGHYTVGKESIDLVLDRIRKLTDACSGLQGFLIFHSFGGGTGSGFT
SLLMERLSLDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDC
AFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNV
DLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVAEITSSCFEPNS
QMVKCDPRHGKYMACCMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTG
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYA
KRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDSFEEENEGEEF

Білок має сайт для зв'язування з нуклеотидами, ГТФ. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Valenstein M.L., Roll-Mecak A. (2016). Graded control of microtubule severing by tubulin glutamylation.. Cell 164: 911 — 921.  PubMed DOI:10.1016/j.cell.2016.01.019

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]