KIF20B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KIF20B
Ідентифікатори
Символи KIF20B, CT90, KRMP1, MPHOSPH1, MPP-1, MPP1, kinesin family member 20B
Зовнішні ІД OMIM: 605498 MGI: 2444576 HomoloGene: 9418 GeneCards: KIF20B
Шаблон експресії
PBB GE MPHOSPH1 205235 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_016195
NM_001284259
NM_183046
NM_001362434
RefSeq (білок)
NP_001271188
NP_057279
NP_898867
NP_001349363
Локус (UCSC) Хр. 10: 89.7 – 89.77 Mb Хр. 19: 34.92 – 34.98 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KIF20B (англ. Kinesin family member 20B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 820 амінокислот, а молекулярна маса — 210 629[4].

Послідовність амінокислот
1020304050
MESNFNQEGVPRPSYVFSADPIARPSEINFDGIKLDLSHEFSLVAPNTEA
NSFESKDYLQVCLRIRPFTQSEKELESEGCVHILDSQTVVLKEPQCILGR
LSEKSSGQMAQKFSFSKVFGPATTQKEFFQGCIMQPVKDLLKGQSRLIFT
YGLTNSGKTYTFQGTEENIGILPRTLNVLFDSLQERLYTKMNLKPHRSRE
YLRLSSEQEKEEIASKSALLRQIKEVTVHNDSDDTLYGSLTNSLNISEFE
ESIKDYEQANLNMANSIKFSVWVSFFEIYNEYIYDLFVPVSSKFQKRKML
RLSQDVKGYSFIKDLQWIQVSDSKEAYRLLKLGIKHQSVAFTKLNNASSR
SHSIFTVKILQIEDSEMSRVIRVSELSLCDLAGSERTMKTQNEGERLRET
GNINTSLLTLGKCINVLKNSEKSKFQQHVPFRESKLTHYFQSFFNGKGKI
CMIVNISQCYLAYDETLNVLKFSAIAQKVCVPDTLNSSQEKLFGPVKSSQ
DVSLDSNSNSKILNVKRATISWENSLEDLMEDEDLVEELENAEETQNVET
KLLDEDLDKTLEENKAFISHEEKRKLLDLIEDLKKKLINEKKEKLTLEFK
IREEVTQEFTQYWAQREADFKETLLQEREILEENAERRLAIFKDLVGKCD
TREEAAKDICATKVETEETHNYVGFEDIIDSLQDNVADIKKQAEIAHLYI
ASLPDPQEATACLELKFNQIKAELAKTKGELIKTKEELKKRENESDSLIQ
ELETSNKKIITQNQRIKELINIIDQKEDTINEFQNLKSHMENTFKCNDKA
DTSSLIINNKLICNETVEVPKDSKSKICSERKRVNENELQQDEPPAKKGS
IHVSSAITEDQKKSEEVRPNIAEIEDIRVLQENNEGLRAFLLTIENELKN
EKEEKAELNKQIVHFQQELSLSEKKNLTLSKEVQQIQSNYDIAIAELHVQ
KSKNQEQEEKIMKLSNEIETATRSITNNVSQIKLMHTKIDELRTLDSVSQ
ISNIDLLNLRDLSNGSEEDNLPNTQLDLLGNDYLVSKQVKEYRIQEPNRE
NSFHSSIEAIWEECKEIVKASSKKSHQIEELEQQIEKLQAEVKGYKDENN
RLKEKEHKNQDDLLKEKETLIQQLKEELQEKNVTLDVQIQHVVEGKRALS
ELTQGVTCYKAKIKELETILETQKVECSHSAKLEQDILEKESIILKLERN
LKEFQEHLQDSVKNTKDLNVKELKLKEEITQLTNNLQDMKHLLQLKEEEE
ETNRQETEKLKEELSASSARTQNLKADLQRKEEDYADLKEKLTDAKKQIK
QVQKEVSVMRDEDKLLRIKINELEKKKNQCSQELDMKQRTIQQLKEQLNN
QKVEEAIQQYERACKDLNVKEKIIEDMRMTLEEQEQTQVEQDQVLEAKLE
EVERLATELEKWKEKCNDLETKNNQRSNKEHENNTDVLGKLTNLQDELQE
SEQKYNADRKKWLEEKMMLITQAKEAENIRNKEMKKYAEDRERFFKQQNE
MEILTAQLTEKDSDLQKWREERDQLVAALEIQLKALISSNVQKDNEIEQL
KRIISETSKIETQIMDIKPKRISSADPDKLQTEPLSTSFEISRNKIEDGS
VVLDSCEVSTENDQSTRFPKPELEIQFTPLQPNKMAVKHPGCTTPVTVKI
PKARKRKSNEMEEDLVKCENKKNATPRTNLKFPISDDRNSSVKKEQKVAI
RPSSKKTYSLRSQASIIGVNLATKKKEGTLQKFGDFLQHSPSILQSKAKK
IIETMSSSKLSNVEASKENVSQPKRAKRKLYTSEISSPIDISGQVILMDQ
KMKESDHQIIKRRLRTKTAK

Кодований геном білок за функціями належить до білкових моторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинний цикл, поділ клітини, мітоз, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті, ядрі, клітинних відростках.

Література[ред. | ред. код]

  • Kamimoto T., Zama T., Aoki R., Muro Y., Hagiwara M. (2001). Identification of a novel kinesin-related protein, KRMP1, as a target for mitotic peptidyl-prolyl isomerase Pin1.. J. Biol. Chem. 276: 37520 — 37528.  PubMed DOI:10.1074/jbc.M106207200
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Westendorf J.M., Rao P.N., Gerace L. (1994). Cloning of cDNAs for M-phase phosphoproteins recognized by the MPM2 monoclonal antibody and determination of the phosphorylated epitope.. Proc. Natl. Acad. Sci. U.S.A. 91: 714 — 718.  PubMed DOI:10.1073/pnas.91.2.714

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7212 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q96Q89 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]