Бета-актин

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Бета-актин
Protein ACTB PDB 1atn.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ACTB, BRWS1, PS1TP5BP1, Beta-actin, actin, beta, actin beta
Зовнішні ІД OMIM: 102630 MGI: 87904 HomoloGene: 110648 GeneCards: ACTB
Пов'язані генетичні захворювання
developmental malformations-deafness-dystonia syndrome, Baraitser-Winter syndrome[1]
Шаблон експресії
PBB GE ACTB 213867 x at fs.png

PBB GE ACTB 200801 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001101
NM_007393
RefSeq (білок)
NP_001092
NP_031419
Локус (UCSC) Хр. 7: 5.53 – 5.56 Mb Хр. 5: 142.9 – 142.91 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Бета-актин (англ. Actin beta) – білок, який кодується геном ACTB, розташованим у людей на короткому плечі 7-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 375 амінокислот, а молекулярна маса — 41 737[5].

Послідовність амінокислот
1020304050
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK
DSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE
HPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTG
IVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSF
TTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITI
GNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS
TFQQMWISKQEYDESGPSIVHRKCF

Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Ponte P., Ng S.Y., Engel J., Gunning P., Kedes L. (1984). Evolutionary conservation in the untranslated regions of actin mRNAs: DNA sequence of a human beta-actin cDNA.. Nucleic Acids Res. 12: 1687 — 1696.  PubMed DOI:10.1093/nar/12.3.1687
  • Nakajima-Iijima S., Hamada H., Reddy P., Kakunaga T. (1985). Molecular structure of the human cytoplasmic beta-actin gene: interspecies homology of sequences in the introns.. Proc. Natl. Acad. Sci. U.S.A. 82: 6133 — 6137.  PubMed DOI:10.1073/pnas.82.18.6133
  • Ohmori H., Toyama S., Toyama S. (1992). Direct proof that the primary site of action of cytochalasin on cell motility processes is actin.. J. Cell Biol. 116: 933 — 941.  PubMed DOI:10.1083/jcb.116.4.933
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hanukoglu I., Tanese N., Fuchs E. (1983). Complementary DNA sequence of a human cytoplasmic actin. Interspecies divergence of 3' non-coding regions.. J. Mol. Biol. 163: 673 — 678.  PubMed DOI:10.1016/0022-2836(83)90117-1
  • Stueven T., Hartmann E., Goerlich D. (2003). Exportin 6: a novel nuclear export receptor that is specific for profilin.actin complexes.. EMBO J. 22: 5928 — 5940.  PubMed DOI:10.1093/emboj/cdg565

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]