MYO7A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYO7A
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MYO7A, DFNA11, DFNB2, MYOVIIA, MYU7A, NSRD2, USH1B, myosin VIIA
Зовнішні ІД OMIM: 276903 MGI: 104510 HomoloGene: 219 GeneCards: MYO7A
Пов'язані генетичні захворювання
autosomal recessive nonsyndromic deafness 2, autosomal dominant nonsyndromic deafness 11, nonsyndromic deafness[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000260
NM_001127179
NM_001127180
NM_001369365
NM_001256081
NM_001256082
NM_001256083
NM_008663
RefSeq (білок)
NP_000251
NP_001120652
NP_001356294
NP_001243010
NP_001243011
NP_001243012
NP_032689
Локус (UCSC) Хр. 11: 77.13 – 77.22 Mb Хр. 7: 98.05 – 98.12 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYO7A (англ. Myosin VIIA) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 2 215 амінокислот, а молекулярна маса — 254 390[5].

Послідовність амінокислот
1020304050
MVILQQGDHVWMDLRLGQEFDVPIGAVVKLCDSGQVQVVDDEDNEHWISP
QNATHIKPMHPTSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGS
ILVAVNPYQLLSIYSPEHIRQYTNKKIGEMPPHIFAIADNCYFNMKRNSR
DQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEATPILEAFG
NAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQALDER
NYHVFYCMLEGMSEDQKKKLGLGQASDYNYLAMGNCITCEGRVDSQEYAN
IRSAMKVLMFTDTENWEISKLLAAILHLGNLQYEARTFENLDACEVLFSP
SLATAASLLEVNPPDLMSCLTSRTLITRGETVSTPLSREQALDVRDAFVK
GIYGRLFVWIVDKINAAIYKPPSQDVKNSRRSIGLLDIFGFENFAVNSFE
QLCINFANEHLQQFFVRHVFKLEQEEYDLESIDWLHIEFTDNQDALDMIA
NKPMNIISLIDEESKFPKGTDTTMLHKLNSQHKLNANYIPPKNNHETQFG
INHFAGIVYYETQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMG
AETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRH
LCVRQLRYSGMMETIRIRRAGYPIRYSFVEFVERYRVLLPGVKPAYKQGD
LRGTCQRMAEAVLGTHDDWQIGKTKIFLKDHHDMLLEVERDKAITDRVIL
LQKVIRGFKDRSNFLKLKNAATLIQRHWRGHNCRKNYGLMRLGFLRLQAL
HRSRKLHQQYRLARQRIIQFQARCRAYLVRKAFRHRLWAVLTVQAYARGM
IARRLHQRLRAEYLWRLEAEKMRLAEEEKLRKEMSAKKAKEEAERKHQER
LAQLAREDAERELKEKEAARRKKELLEQMERARHEPVNHSDMVDKMFGFL
GTSGGLPGQEGQAPSGFEDLERGRREMVEEDLDAALPLPDEDEEDLSEYK
FAKFAATYFQGTTTHSYTRRPLKQPLLYHDDEGDQLAALAVWITILRFMG
DLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKRELQALQGEGEAQLPE
GQKKSSVRHKLVHLTLKKKSKLTEEVTKRLHDGESTVQGNSMLEDRPTSN
LEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVG
CFAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQ
ATKSKKPIMLPVTFMDGTTKTLLTDSATTAKELCNALADKISLKDRFGFS
LYIALFDKVSSLGSGSDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEV
FTPWHSPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQYFVDY
GSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAHKKGIYAQRRTD
AQKVKEDVVSYARFKWPLLFSRFYEAYKFSGPSLPKNDVIVAVNWTGVYF
VDEQEQVLLELSFPEIMAVSSSRECRVWLSLGCSDLGCAAPHSGWAGLTP
AGPCSPCWSCRGAKTTAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEG
LRKRSKYVVALQDNPNPAGEESGFLSFAKGDLIILDHDTGEQVMNSGWAN
GINERTKQRGDFPTDSVYVMPTVTMPPREIVALVTMTPDQRQDVVRLLQL
RTAEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARGKDRLWSHTRE
PLKQALLKKLLGSEELSQEACLAFIAVLKYMGDYPSKRTRSVNELTDQIF
EGPLKAEPLKDEAYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNIL
LPHVQRFLQSRKHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTT
QIFHKVYFPDDTDEAFEVESSTKAKDFCQNIATRLLLKSSEGFSLFVKIA
DKVLSVPENDFFFDFVRHLTDWIKKARPIKDGIVPSLTYQVFFMKKLWTT
TVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVKFEEDK
SYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAF
LKLIFKWPTFGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPKTKDILT
THPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQ
MLTAMSKQRGSRSGK

Кодований геном білок за функціями належить до білкових моторів, міозинів, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою актину, молекулою кальмодуліну. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Bement W.M., Hasson T., Wirth J.A., Cheney R.E., Mooseker M.S. (1994). Identification and overlapping expression of multiple unconventional myosin genes in vertebrate cell types.. Proc. Natl. Acad. Sci. U.S.A. 91: 6549 — 6553.  PubMed DOI:10.1073/pnas.91.14.6549
  • Bement W.M., Hasson T., Wirth J.A., Cheney R.E., Mooseker M.S. (1994). Proc. Natl. Acad. Sci. U.S.A. 91: 11767 — 11767.  PubMed DOI:10.1073/pnas.91.24.11767c
  • Hasson T., Heintzelman M.B., Santos-Sacchi J., Corey D.P., Mooseker M.S. (1995). Expression in cochlea and retina of myosin VIIa, the gene product defective in Usher syndrome type 1B.. Proc. Natl. Acad. Sci. U.S.A. 92: 9815 — 9819.  PubMed DOI:10.1073/pnas.92.21.9815
  • Heissler S.M., Manstein D.J. (2012). Functional characterization of the human myosin-7a motor domain.. Cell. Mol. Life Sci. 69: 299 — 311.  PubMed DOI:10.1007/s00018-011-0749-8
  • Grati M., Kachar B. (2011). Myosin VIIa and sans localization at stereocilia upper tip-link density implicates these Usher syndrome proteins in mechanotransduction.. Proc. Natl. Acad. Sci. U.S.A. 108: 11476 — 11481.  PubMed DOI:10.1073/pnas.1104161108
  • Bharadwaj A.K., Kasztejna J.P., Huq S., Berson E.L., Dryja T.P. (2000). Evaluation of the myosin VIIA gene and visual function in patients with Usher syndrome type I.. Exp. Eye Res. 71: 173 — 181.  PubMed DOI:10.1006/exer.2000.0863

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]