MYLPF

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYLPF
Ідентифікатори
Символи MYLPF, HUMMLC2B, MRLC2, MYL11, MLC2B, myosin light chain, phosphorylatable, fast skeletal muscle
Зовнішні ІД OMIM: 617378 MGI: 97273 HomoloGene: 22728 GeneCards: MYLPF
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_013292
NM_001324458
NM_001324459
NM_016754
NM_001347655
RefSeq (білок)
NP_001311387
NP_001311388
NP_037424
NP_001334584
NP_058034
Локус (UCSC) Хр. 16: 30.37 – 30.38 Mb Хр. 7: 127.21 – 127.21 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYLPF (англ. Myosin light chain, phosphorylatable, fast skeletal muscle) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 169 амінокислот, а молекулярна маса — 19 015[4].

Послідовність амінокислот
1020304050
MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDL
RDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVI
TGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGN
VDYKNICYVITHGDAKDQE

Кодований геном білок за функціями належить до білкових моторів, міозинів, м'язових білків, фосфопротеїнів. Білок має сайт для зв'язування з іонами металів, іоном кальцію.

Література[ред. | ред. код]

  • Sachdev S., Raychowdhury M.K., Sarkar S. (2003). Human fast skeletal myosin light chain 2 cDNA: isolation, tissue specific expression of the single copy gene, comparative sequence analysis of isoforms and evolutionary relationships.. DNA Seq. 14: 339 — 350.  PubMed DOI:10.1080/1042517031000154952
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:29824 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q96A32 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]