Кератин 77

Матеріал з Вікіпедії — вільної енциклопедії.
(Перенаправлено з KRT77)
Перейти до навігації Перейти до пошуку
Кератин 77
Ідентифікатори
Символи KRT77, K1B, KRT1B, keratin 77
Зовнішні ІД OMIM: 611158 MGI: 3588209 HomoloGene: 45490 GeneCards: KRT77
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_175078
NM_001003667
RefSeq (білок)
NP_778253
NP_778253.2
NP_001003667
Локус (UCSC) Хр. 12: 52.69 – 52.7 Mb Хр. 15: 101.86 – 101.87 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Кератин 77 (англ. Keratin 77) – білок, який кодується геном KRT77, розташованим у людей на короткому плечі 12-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 578 амінокислот, а молекулярна маса — 61 901[4].

Послідовність амінокислот
1020304050
MSHQFSSQSAFSSMSRRVYSTSSSAGSGGGSPAVGSVCYARGRCGGGGYG
IHGRGFGSRSLYNLGGSRSISINLMGRSTSGFCQGGGVGGFGGGRGFGVG
STGAGGFGGGGFGGAGFGTSNFGLGGFGPYCPPGGIQEVTINQSLLEPLH
LEVDPEIQRIKTQEREQIMVLNNKFASFIDKVRFLEQQNQVLQTKWELLQ
QVNTSTGTNNLEPLLENYIGDLRRQVDLLSAEQMRQNAEVRSMQDVVEDY
KSKYEDEINKRTGSENDFVVLKKDVDAAYVSKVDLESRVDTLTGEVNFLK
YLFLTELSQVQTHISDTNVILSMDNNRSLDLDSIIDAVRTQYELIAQRSK
DEAEALYQTKYQELQITAGRHGDDLKNSKMEIAELNRTVQRLQAEISNVK
KQIEQMQSLISDAEERGEQALQDAWQKLQDLEEALQQSKEELARLLRDYQ
AMLGVKLSLDVEIATYRQLLEGEESRMSGELQSHVSISVQNSQVSVNGGA
GGGGSYGSGGYGGGSGGGYGGGRSYRGGGARGRSGGGYGSGCGGGGGSYG
GSGRSGRGSSRVQIIQTSTNTSHRRILE

Література[ред. | ред. код]

  • Hesse M., Magin T.M., Weber K. (2001). Genes for intermediate filament proteins and the draft sequence of the human genome: novel keratin genes and a surprisingly high number of pseudogenes related to keratin genes 8 and 18.. J. Cell Sci. 114: 2569 — 2575.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:20411 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, Q7Z794 (англ.). Процитовано 30 січня 2017. 

Див. також[ред. | ред. код]