KRT81

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KRT81
Ідентифікатори
Символи KRT81, HB1, Hb-1, KRTHB1, MLN137, ghHkb1, hHAKB2-1, keratin 81
Зовнішні ІД OMIM: 602153 MGI: 1928858 HomoloGene: 55645 GeneCards: KRT81
Пов'язані генетичні захворювання
monilethrix[1]
Шаблон експресії
PBB GE KRT81 213711 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002281
NM_001166157
RefSeq (білок)
NP_002272
NP_001159629
Локус (UCSC) Хр. 12: 52.29 – 52.29 Mb Хр. 15: 101.46 – 101.46 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KRT81 (англ. Keratin 81) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 505 амінокислот, а молекулярна маса — 54 928[5].

Послідовність амінокислот
1020304050
MTCGSGFGGRAFSCISACGPRPGRCCITAAPYRGISCYRGLTGGFGSHSV
CGGFRAGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQ
CVKQEEKEQIKSLNSRFAAFIDKVRFLEQQNKLLETKLQFYQNRECCQSN
LEPLFEGYIETLRREAECVEADSGRLASELNHVQEVLEGYKKKYEEEVSL
RATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLRRLYEEEILIL
QSHISDTSVVVKLDNSRDLNMDCIIAEIKAQYDDIVTRSRAEAESWYRSK
CEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAV
AQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLD
IEIATYRRLLEGEEQRLCEGIGAVNVCVSSSRGGVVCGDLCVSGSRPVTG
SVCSAPCNGNVAVSTGLCAPCGQLNTTCGGGSCGVGSCGISSLGVGSCGS
SCRKC

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bowden P.E., Hainey S., Parker G., Hodgins M.B. (1994). Sequence and expression of human hair keratin genes.. J. Dermatol. Sci. 7: S152 — S163.  PubMed DOI:10.1016/0923-1811(94)90046-9

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]