MYLK2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYLK2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MYLK2, KMLC, MLCK, MLCK2, skMLCK, myosin light chain kinase 2
Зовнішні ІД OMIM: 606566 MGI: 2139434 HomoloGene: 13223 GeneCards: MYLK2
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_033118
NM_001081044
RefSeq (білок)
NP_149109
NP_001074513
Локус (UCSC) Хр. 20: 31.82 – 31.83 Mb Хр. 2: 152.91 – 152.92 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYLK2 (англ. Myosin light chain kinase 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 596 амінокислот, а молекулярна маса — 64 685[4].

Послідовність амінокислот
1020304050
MATENGAVELGIQNPSTDKAPKGPTGERPLAAGKDPGPPDPKKAPDPPTL
KKDAKAPASEKGDGTLAQPSTSSQGPKGEGDRGGGPAEGSAGPPAALPQQ
TATPETSVKKPKAEQGASGSQDPGKPRVGKKAAEGQAAARRGSPAFLHSP
SCPAIISSSEKLLAKKPPSEASELTFEGVPMTHSPTDPRPAKAEEGKNIL
AESQKEVGEKTPGQAGQAKMQGDTSRGIEFQAVPSEKSEVGQALCLTARE
EDCFQILDDCPPPPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVC
TCMEKATGLKLAAKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLYAAIE
TPHEIVLFMEYIEGGELFERIVDEDYHLTEVDTMVFVRQICDGILFMHKM
RVLHLDLKPENILCVNTTGHLVKIIDFGLARRYNPNEKLKVNFGTPEFLS
PEVVNYDQISDKTDMWSMGVITYMLLSGLSPFLGDDDTETLNNVLSGNWY
FDEETFEAVSDEAKDFVSNLIVKDQRARMNAAQCLAHPWLNNLAEKAKRC
NRRLKSQILLKKYLMKRRWKKNFIAVSAANRFKKISSSGALMALGV

Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, фосфопротеїнів. Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з АТФ, нуклеотидами, молекулою кальмодуліну. Локалізований у цитоплазмі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:16243 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9H1R3 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]