Легкий ланцюг міозину 9

Матеріал з Вікіпедії — вільної енциклопедії.
(Перенаправлено з MYL9)
Перейти до навігації Перейти до пошуку
Легкий ланцюг міозину 9
Ідентифікатори
Символи MYL9, LC20, MLC-2C, MLC2, MRLC1, MYRL2, myosin light chain 9
Зовнішні ІД OMIM: 609905 MGI: 2138915 HomoloGene: 21230 GeneCards: MYL9
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_181526
NM_006097
NM_172118
RefSeq (білок)
NP_006088
NP_852667
NP_742116
Локус (UCSC) Хр. 20: 36.54 – 36.55 Mb Хр. 2: 156.78 – 156.78 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Легкий ланцюг міозину 9 (англ. Myosin light chain 9) – білок, який кодується геном MYL9, розташованим у людей на короткому плечі 20-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 172 амінокислот, а молекулярна маса — 19 827[4].

Послідовність амінокислот
1020304050
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFID
KEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPE
DVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDK
KGNFNYVEFTRILKHGAKDKDD

Цей білок за функціями належить до білкових моторів, міозинів, м'язових білків. Білок має сайт для зв'язування з іонами металів, іоном кальцію.

Література[ред. | ред. код]

  • Kumar C.C., Mohan S.R., Zavodny P.J., Narula S.K., Leibowitz P.J. (1989). Characterization and differential expression of human vascular smooth muscle myosin light chain 2 isoform in nonmuscle cells.. Biochemistry 28: 4027 — 4035.  PubMed DOI:10.1021/bi00435a059
  • Iwasaki T., Murata-Hori M., Ishitobi S., Hosoya H. (2001). Diphosphorylated MRLC is required for organization of stress fibers in interphase cells and the contractile ring in dividing cells.. Cell Struct. Funct. 26: 677 — 683.  PubMed DOI:10.1247/csf.26.677
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tan I., Yong J., Dong J.M., Lim L., Leung T. (2008). A tripartite complex containing MRCK modulates lamellar actomyosin retrograde flow.. Cell 135: 123 — 136.  PubMed DOI:10.1016/j.cell.2008.09.018
  • Tan I., Lai J., Yong J., Li S.F., Leung T. (2011). Chelerythrine perturbs lamellar actomyosin filaments by selective inhibition of myotonic dystrophy kinase-related Cdc42-binding kinase.. FEBS Lett. 585: 1260 — 1268.  PubMed DOI:10.1016/j.febslet.2011.03.054
  • Shoval Y., Berissi H., Kimchi A., Pietrokovski S. (2011). New modularity of DAP-kinases: alternative splicing of the DRP-1 gene produces a ZIPk-like isoform.. PLoS ONE 6: E17344 — E17344.  PubMed DOI:10.1371/journal.pone.0017344

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:15754 (англ.). Процитовано 21 серпня 2017. 
  4. UniProt, P24844 (англ.). Процитовано 21 серпня 2017. 

Див. також[ред. | ред. код]