KRT33A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KRT33A
Ідентифікатори
Символи KRT33A, HA3I, Ha-3I, K33A, KRTHA3A, Krt1-3, hHa3-I, keratin 33A
Зовнішні ІД OMIM: 602761 HomoloGene: 135742 GeneCards: KRT33A
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004138
н/д
RefSeq (білок)
NP_004129
н/д
Локус (UCSC) Хр. 17: 41.35 – 41.35 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

KRT33A (англ. Keratin 33A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 404 амінокислот, а молекулярна маса — 45 940[3].

Послідовність амінокислот
1020304050
MSYSCGLPSLSCRTSCSSRPCVPPSCHGCTLPGACNIPANVSNCNWFCEG
SFNGSEKETMQFLNDRLASYLEKVRQLERDNAELENLIRERSQQQEPLVC
ASYQSYFKTIEELQQKILCSKSENARLVVQIDNAKLASDDFRTKYETELS
LRQLVESDINGLRRILDELTLCRSDLEAQVESLKEELLCLKQNHEQEVNT
LRCQLGDRLNVEVDAAPTVDLNQVLNETRSQYEALVETNRREVEQWFATQ
TEELNKQVVSSSEQLQSYQAEIIELRRTVNALEIELQAQHNLRDSLENTL
TESEARYSSQLSQVQRLITNVESQLAEIRSDLERQNQEYQVLLDVRARLE
CEINTYRSLLESEDCKLPSNPCATTNACDKSTGPCISNPCGLRARCGPCN
TFGY

Локалізований у проміжних філаментах.

Література[ред. | ред. код]

  • Rogers M.A., Winter H., Wolf C., Heck M., Schweizer J. (1998). Characterization of a 190-kilobase pair domain of human type I hair keratin genes.. J. Biol. Chem. 273: 26683 — 26691.  PubMed DOI:10.1074/jbc.273.41.26683
  • Rogers M.A., Winter H., Langbein L., Bleiler R., Schweizer J. (2004). The human type I keratin gene family: characterization of new hair follicle specific members and evaluation of the chromosome 17q21.2 gene domain.. Differentiation 72: 527 — 540.  PubMed DOI:10.1111/j.1432-0436.2004.07209006.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:6450 (англ.). Процитовано 12 вересня 2017. 
  3. UniProt, O76009 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]