DYNC1LI1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DYNC1LI1
Ідентифікатори
Символи DYNC1LI1, DNCLI1, LIC1, dynein cytoplasmic 1 light intermediate chain 1, DLC-A
Зовнішні ІД OMIM: 615890 MGI: 2135610 HomoloGene: 9403 GeneCards: DYNC1LI1
Шаблон експресії
PBB GE DYNC1LI1 217976 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_016141
NM_001329135
NM_146229
RefSeq (білок)
NP_001316064
NP_057225
NP_666341
Локус (UCSC) Хр. 3: 32.53 – 32.57 Mb Хр. 9: 114.69 – 114.72 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

DYNC1LI1 (англ. Dynein cytoplasmic 1 light intermediate chain 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 523 амінокислот, а молекулярна маса — 56 579[4].

Послідовність амінокислот
1020304050
MAAVGRVGSFGSSPPGLSSTYTGGPLGNEIASGNGGAAAGDDEDGQNLWS
CILSEVSTRSRSKLPAGKNVLLLGEDGAGKTSLIRKIQGIEEYKKGRGLE
YLYLNVHDEDRDDQTRCNVWILDGDLYHKGLLKFSLDAVSLKDTLVMLVV
DMSKPWTALDSLQKWASVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEP
GEDFPASPQRRNTASQEDKDDSVVLPLGADTLTHNLGIPVLVVCTKCDAI
SVLEKEHDYRDEHFDFIQSHIRKFCLQYGAALIYTSVKENKNIDLVYKYI
VQKLYGFPYKIPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDNFE
DIITKPPVRKFVHEKEIMAEDDQVFLMKLQSLLAKQPPTAAGRPVDASPR
VPGGSPRTPNRSVSSNVASVSPIPAGSKKIDPNMKAGATSEGVLANFFNS
LLSKKTGSPGGPGVSGGSPAGGAGGGSSGLPPSTKKSGQKPVLDVHAELD
RITRKPVTVSPTTPTSPTEGEAS

Кодований геном білок за функціями належить до білкових моторів, фосфопротеїнів. Задіяний у таких біологічних процесах як взаємодія хазяїн-вірус, транспорт, клітинний цикл, поділ клітини, мітоз, поліморфізм. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті, хромосомах, центромерах, кінетохорі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Sivaram M.V., Wadzinski T.L., Redick S.D., Manna T., Doxsey S.J. (2009). Dynein light intermediate chain 1 is required for progress through the spindle assembly checkpoint.. EMBO J. 28: 902 — 914.  PubMed DOI:10.1038/emboj.2009.38

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:18745 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q9Y6G9 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]