KRT79

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KRT79
Ідентифікатори
Символи KRT79, K6L, KRT6L, keratin 79
Зовнішні ІД OMIM: 611160 MGI: 2385030 HomoloGene: 89169 GeneCards: KRT79
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_175834
NM_146063
RefSeq (білок)
NP_787028
NP_666175
Локус (UCSC) Хр. 12: 52.82 – 52.83 Mb Хр. 15: 101.93 – 101.94 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KRT79 (англ. Keratin 79) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 535 амінокислот, а молекулярна маса — 57 836[4].

Послідовність амінокислот
1020304050
MRSSVSRQTYSTKGGFSSNSASGGSGSQARTSFSSVTVSRSSGSGGGAHC
GPGTGGFGSRSLYNLGGHKSISVSVAGGALLGRALGGFGFGSRAFMGQGA
GRQTFGPACPPGGIQEVTVNQSLLTPLHVEIDPEIQRVRTQEREQIKTLN
NKFASFIDKVRFLEQQNKVLETKWALLQEQGQNLGVTRNNLEPLFEAYLG
SMRSTLDRLQSERGRLDSELRNVQDLVEDFKNKYEDEINKHTAAENEFVV
LKKDVDAAYMGRMDLHGKVGTLTQEIDFLQQLYEMELSQVQTHVSNTNVV
LSMDNNRNLDLDSIIAEVKAQYELIAQRSRAEAEAWYQTKYEELQVTAGK
HGDNLRDTKNEIAELTRTIQRLQGEADAAKKQCQQLQTAIAEAEQRGELA
LKDAQKKLGDLDVALHQAKEDLTRLLRDYQELMNVKLALDVEIATYRKLL
ESEESRMSGECPSAVSISVTGNSTTVCGGGAASFGGGISLGGSGGATKGG
FSTNVGYSTVKGGPVSAGTSILRKTTTVKTSSQRY

Локалізований у проміжних філаментах.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hesse M., Magin T.M., Weber K. (2001). Genes for intermediate filament proteins and the draft sequence of the human genome: novel keratin genes and a surprisingly high number of pseudogenes related to keratin genes 8 and 18.. J. Cell Sci. 114: 2569 — 2575.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:28930 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q5XKE5 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]