Філамін B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Філамін B
Protein FLNB PDB 2di8.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FLNB, ABP-278, ABP-280, AOI, FH1, FLN-B, FLN1L, LRS1, SCT, TABP, TAP, filamin B
Зовнішні ІД OMIM: 603381 MGI: 2446089 HomoloGene: 37480 GeneCards: FLNB
Пов'язані генетичні захворювання
atelosteogenesis, Boomerang dysplasia, Larsen syndrome, spondylocarpotarsal synostosis syndrome[1]
Шаблон експресії
PBB GE FLNB 208613 s at fs.png

PBB GE FLNB 208614 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001164317
NM_001164318
NM_001164319
NM_001457
NM_001081427
NM_134080
RefSeq (білок)
NP_001157789
NP_001157790
NP_001157791
NP_001448
NP_001074896
NP_598841
Локус (UCSC) Хр. 3: 58.01 – 58.17 Mb Хр. 14: 7.82 – 7.95 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Філамін B (англ. Filamin B) – білок, який кодується геном FLNB, розташованим у людей на короткому плечі 3-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 2 602 амінокислот, а молекулярна маса — 278 164[5].

Послідовність амінокислот
1020304050
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRL
IALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSK
AIVDGNLKLILGLVWTLILHYSISMPVWEDEGDDDAKKQTPKQRLLGWIQ
NKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPQKPVDNARE
AMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKP
KLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKA
QGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKN
TVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEAC
NPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEEL
VKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQ
KVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRA
YGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRM
DGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGP
GVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDII
HNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKA
EGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLN
GLENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRE
NSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGL
EGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYL
PTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGE
AGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTD
FTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKG
LHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFT
VVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNIT
YGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVLQSFTVDSSKA
GLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEG
LLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIP
LSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTC
TVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPF
TVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLV
IPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAG
EGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIP
GSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRDE
PCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIG
DARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTE
DLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESIT
RTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGK
NSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGG
PGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGV
SYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGL
KVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPH
ENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTG
IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNY
LISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTET
CYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVH
GPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVT
VP

Цей білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах як диференціація, міогенез. Білок має сайт для зв'язування з молекулою актину. Локалізований у цитоплазмі, цитоскелеті.

Література[ред. | ред. код]

  • Takafuta T., Wu G., Murphy G.F., Shapiro S.S. (1998). Human beta-filamin is a new protein that interacts with the cytoplasmic tail of glycoprotein Ibalpha.. J. Biol. Chem. 273: 17531 — 17538.  PubMed DOI:10.1074/jbc.273.28.17531
  • Kato S., Ohtoko K., Ohtake H., Kimura T. (2005). Vector-capping: a simple method for preparing a high-quality full-length cDNA library.. DNA Res. 12: 53 — 62.  PubMed DOI:10.1093/dnares/12.1.53
  • Huang C.J., Chen Y.H., Ting L.P. (2000). Hepatitis B virus core protein interacts with the C-terminal region of actin-binding protein.. J. Biomed. Sci. 7: 160 — 168.  PubMed DOI:10.1007/BF02256623
  • Takafuta T., Saeki M., Fujimoto T.-T., Fujimura K., Shapiro S.S. (2003). A new member of the LIM protein family binds to filamin B and localizes at stress fibers.. J. Biol. Chem. 278: 12175 — 12181.  PubMed DOI:10.1074/jbc.M209339200
  • Himmel M., van der Ven P.F.M., Stoecklein W., Fuerst D.O. (2003). The limits of promiscuity: isoform-specific dimerization of filamins.. Biochemistry 42: 430 — 439.  PubMed DOI:10.1021/bi026501+
  • van der Flier A., Sonnenberg A. (2001). Structural and functional aspects of filamins.. Biochim. Biophys. Acta 1538: 99 — 117.  PubMed DOI:10.1016/S0167-4889(01)00072-6

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]