TRIOBP

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TRIOBP
Ідентифікатори
Символи TRIOBP, DFNB28, TAP68, TARA, dJ37E16.4, HRIHFB2122, TRIO and F-actin binding protein
Зовнішні ІД OMIM: 609761 MGI: 1349410 HomoloGene: 5104 GeneCards: TRIOBP
Пов'язані генетичні захворювання
autosomal recessive nonsyndromic deafness 28[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_138632
NM_001039141
NM_007032
NM_001024716
NM_001039155
NM_001039156
NM_138579
RefSeq (білок)
NP_001034230
NP_008963
NP_619538
NP_001019887
NP_001034244
NP_001034245
NP_613045
Локус (UCSC) Хр. 22: 37.7 – 37.78 Mb Хр. 15: 78.95 – 79.01 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TRIOBP (англ. TRIO and F-actin binding protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 2 365 амінокислот, а молекулярна маса — 261 376[5].

Послідовність амінокислот
1020304050
MEEVPGDALCEHFEANILTQNRCQNCFHPEEAHGARYQELRSPSGAEVPY
CDLPRCPPAPEDPLSASTSGCQSVVDPGLRPGPKRGPSPSAGLPEEGPTA
APRSRSRELEAVPYLEGLTTSLCGSCNEDPGSDPTSSPDSATPDDTSNSS
SVDWDTVERQEEEAPSWDELAVMIPRRPREGPRADSSQRAPSLLTRSPVG
GDAAGQKKEDTGGGGRSAGQHWARLRGESGLSLERHRSTLTQASSMTPHS
GPRSTTSQASPAQRDTAQAASTREIPRASSPHRITQRDTSRASSTQQEIS
RASSTQQETSRASSTQEDTPRASSTQEDTPRASSTQWNTPRASSPSRSTQ
LDNPRTSSTQQDNPQTSFPTCTPQRENPRTPCVQQDDPRASSPNRTTQRE
NSRTSCAQRDNPKASRTSSPNRATRDNPRTSCAQRDNPRASSPSRATRDN
PTTSCAQRDNPRASRTSSPNRATRDNPRTSCAQRDNPRASSPSRATRDNP
TTSCAQRDNPRASRTSSPNRATRDNPRTSCAQRDNPRASSPNRAARDNPT
TSCAQRDNPRASRTSSPNRATRDNPRTSCAQRDNPRASSPNRATRDNPTT
SCAQRDNPRASRTSSPNRATRDNPRTSCAQRDNPRASSPNRTTQQDSPRT
SCARRDDPRASSPNRTIQQENPRTSCALRDNPRASSPSRTIQQENPRTSC
AQRDDPRASSPNRTTQQENPRTSCARRDNPRASSRNRTIQRDNPRTSCAQ
RDNPRASSPNRTIQQENLRTSCTRQDNPRTSSPNRATRDNPRTSCAQRDN
LRASSPIRATQQDNPRTCIQQNIPRSSSTQQDNPKTSCTKRDNLRPTCTQ
RDRTQSFSFQRDNPGTSSSQCCTQKENLRPSSPHRSTQWNNPRNSSPHRT
NKDIPWASFPLRPTQSDGPRTSSPSRSKQSEVPWASIALRPTQGDRPQTS
SPSRPAQHDPPQSSFGPTQYNLPSRATSSSHNPGHQSTSRTSSPVYPAAY
GAPLTSPEPSQPPCAVCIGHRDAPRASSPPRYLQHDPFPFFPEPRAPESE
PPHHEPPYIPPAVCIGHRDAPRASSPPRHTQFDPFPFLPDTSDAEHQCQS
PQHEPLQLPAPVCIGYRDAPRASSPPRQAPEPSLLFQDLPRASTESLVPS
MDSLHECPHIPTPVCIGHRDAPSFSSPPRQAPEPSLFFQDPPGTSMESLA
PSTDSLHGSPVLIPQVCIGHRDAPRASSPPRHPPSDLAFLAPSPSPGSSG
GSRGSAPPGETRHNLEREEYTVLADLPPPRRLAQRQPGPQAQCSSGGRTH
SPGRAEVERLFGQERRKSEAAGAFQAQDEGRSQQPSQGQSQLLRRQSSPA
PSRQVTMLPAKQAELTRRSQAEPPHPWSPEKRPEGDRQLQGSPLPPRTSA
RTPERELRTQRPLESGQAGPRQPLGVWQSQEEPPGSQGPHRHLERSWSSQ
EGGLGPGGWWGCGEPSLGAAKAPEGAWGGTSREYKESWGQPEAWEEKPTH
ELPRELGKRSPLTSPPENWGGPAESSQSWHSGTPTAVGWGAEGACPYPRG
SERRPELDWRDLLGLLRAPGEGVWARVPSLDWEGLLELLQARLPRKDPAG
HRDDLARALGPELGPPGTNDVPEQESHSQPEGWAEATPVNGHSPALQSQS
PVQLPSPACTSTQWPKIKVTRGPATATLAGLEQTGPLGSRSTAKGPSLPE
LQFQPEEPEESEPSRGQDPLTDQKQADSADKRPAEGKAGSPLKGRLVTSW
RMPGDRPTLFNPFLLSLGVLRWRRPDLLNFKKGWMSILDEPGEPPSPSLT
TTSTSQWKKHWFVLTDSSLKYYRDSTAEEADELDGEIDLRSCTDVTEYAV
QRNYGFQIHTKDAVYTLSAMTSGIRRNWIEALRKTVRPTSAPDVTKLSDS
NKENALHSYSTQKGPLKAGEQRAGSEVISRGGPRKADGQRQALDYVELSP
LTQASPQRARTPARTPDRLAKQEELERDLAQRSEERRKWFEATDSRTPEV
PAGEGPRRGLGAPLTEDQQNRLSEEIEKKWQELEKLPLRENKRVPLTALL
NQSRGERRGPPSDGHEALEKEVQALRAQLEAWRLQGEAPQSALRSQEDGH
IPPGYISQEACERSLAEMESSHQQVMEELQRHHERELQRLQQEKEWLLAE
ETAATASAIEAMKKAYQEELSRELSKTRSLQQGPDGLRKQHQSDVEALKR
ELQVLSEQYSQKCLEIGALMRQAEEREHTLRRCQQEGQELLRHNQELHGR
LSEEIDQLRGFIASQGMGNGCGRSNERSSCELEVLLRVKENELQYLKKEV
QCLRDELQMMQKDKRFTSGKYQDVYVELSHIKTRSEREIEQLKEHLRLAM
AALQEKESMRNSLAE

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинний цикл, поділ клітини, мітоз, альтернативний сплайсинг. Білок має сайт для зв'язування з молекулою актину. Локалізований у цитоплазмі, цитоскелеті, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hirosawa M., Nagase T., Murahashi Y., Kikuno R., Ohara O. (2001). Identification of novel transcribed sequences on human chromosome 22 by expressed sequence tag mapping.. DNA Res. 8: 1 — 9.  PubMed DOI:10.1093/dnares/8.1.1
  • Seipel K., O'Brien S.P., Iannotti E., Medley Q.G., Streuli M. (2001). Tara, a novel F-actin binding protein, associates with the Trio guanine nucleotide exchange factor and regulates actin cytoskeletal organization.. J. Cell Sci. 114: 389 — 399.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]