Ламін B2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Ламін B2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи LMNB2, lamin B2, LAMB2, LMN2, EPM9
Зовнішні ІД OMIM: 150341 MGI: 96796 HomoloGene: 7818 GeneCards: LMNB2
Пов'язані генетичні захворювання
Barraquer–Simons syndrome[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_032737
NM_010722
NM_001347140
RefSeq (білок)
NP_116126
NP_001334069
NP_034852
Локус (UCSC) Хр. 19: 2.43 – 2.46 Mb Хр. 10: 80.9 – 80.92 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Ламін B2 (англ. Lamin B2) – білок, який кодується геном LMNB2, розташованим у людей на короткому плечі 19-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 620 амінокислот, а молекулярна маса — 69 948[5].

Послідовність амінокислот
1020304050
MSPPSPGRRREQRRPRAAATMATPLPGRAGGPATPLSPTRLSRLQEKEEL
RELNDRLAHYIDRVRALELENDRLLLKISEKEEVTTREVSGIKALYESEL
ADARRVLDETARERARLQIEIGKLRAELDEVNKSAKKREGELTVAQGRVK
DLESLFHRSEVELAAALSDKRGLESDVAELRAQLAKAEDGHAVAKKQLEK
ETLMRVDLENRCQSLQEELDFRKSVFEEEVRETRRRHERRLVEVDSSRQQ
EYDFKMAQALEELRSQHDEQVRLYKLELEQTYQAKLDSAKLSSDQNDKAA
SAAREELKEARMRLESLSYQLSGLQKQASAAEDRIRELEEAMAGERDKFR
KMLDAKEQEMTEMRDVMQQQLAEYQELLDVKLALDMEINAYRKLLEGEEE
RLKLSPSPSSRVTVSRATSSSSGSLSATGRLGRSKRKRLEVEEPLGSGPS
VLGTGTGGSGGFHLAQQASASGSVSIEEIDLEGKFVQLKNNSDKDQSLGN
WRIKRQVLEGEEIAYKFTPKYILRAGQMVTVWAAGAGVAHSPPSTLVWKG
QSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENGEEEEEEAEFGE
EDLFHQQGDPRTTSRGCYVM

Локалізований у ядрі, мембрані.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J. (2008). Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.. J. Proteome Res. 7: 5167 — 5176.  PubMed DOI:10.1021/pr800500r
  • Gao J., Li Y., Fu X., Luo X. (2012). A Chinese patient with acquired partial lipodystrophy caused by a novel mutation with LMNB2 gene.. J. Pediatr. Endocrinol. Metab. 25: 375 — 377.  PubMed

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]